IGF-I/IGF-1 Protein, Human (70a.a)

IGF-I/IGF-1 Protein, Human (70a.a) is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone; IGF-I/IGF-1 Protein also mediates neuroprotective mechanism.

Insulin-like growth factor (IGF) system has been shown to modulate growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. Insulin-like Growth factor-1 (IGF-I) is produced by osteoblasts, and its mitogenic effects are mediated by their binding to the IGF plasma membrane receptors. The IGF type 1 receptor binding to both IGF-I and IGF-II, is thought to be the predominate receptor involved in mediating the effects of these growth factors in most cell types, including osteoblasts^[1]. Insulin-like growth factor-1 (IGF-1) is a neurotrophic factor capable of mediating neuroprotective and neuroplasticity mechanisms. Targeted overexpression of IGF-1 enhances the generation of hippocampal newborn neurons in brain-injured mice^[2].

1.ED₅₀ < 5 ng/mL, measured by a cell proliferation assay using FDC-P1 cells, corresponding to a specific activity of > 2.0×10⁵ units/mg.
2. Measured in cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is ≤65 ng/mL.

• 
  Measured in cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is ≤65 ng/mL.

Human

E. coli

Tag Free

P05019-1 (G49-A118)

3479  [NCBI]

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

7-10 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or 20 mM NaAc-HAc, pH 4.5 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140(10):4699-705.  [Content Brief]

  [2]. Carlson SW, et al. Central Infusion of Insulin-Like Growth Factor-1 Increases Hippocampal Neurogenesis and Improves Neurobehavioral Function after Traumatic Brain Injury. J Neurotrauma. 2018 Jul 1;35(13):1467-1480.  [Content Brief]