1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. Insulin-like Growth Factor I (IGF-1)
  5. IGF-I/IGF-1 Protein, Mouse

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 Protein, Mouse is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg USD 37 In-stock
10 μg USD 95 In-stock
50 μg USD 200 In-stock
100 μg USD 368 Get quote
> 100 μg   Get quote  

Get it by June 3 for select sizes. Order within 11 hrs 28 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IGF-I/IGF-1 Protein is an insulin-like growth factor that possesses both growth-promoting and metabolic-regulating functions. IGF-I/IGF-1 Protein is also a neurotrophic factor with neuroprotective and neuroplasticity-regulating activities. IGF-I/IGF-1 Protein plays a key role in growth and development, cell proliferation, metabolic regulation and other aspects. IGF-I/IGF-1 Protein, Mouse is a recombinant IGF-I/IGF-1 protein expressed by E. coli without a tag[1][2].

Background

IGF system has been demonstrated to regulate the growth of numerous tissues, such as neural tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. IGF-I/IGF-1, a key growth factor involved in cell growth, differentiation, survival, and cell cycle regulation, is secreted by mature osteoblasts, stored in the bone matrix, and released during bone resorption. The mitogenic effect of IGF-I/IGF-1 is mediated through its binding to IGF plasma membrane receptors. IGF-I/IGF-1 can stimulate osteoblast proliferation and differentiation, and also promote neuronal survival[1][2].

In Vitro

IGF-I/IGF-1 Protein (Mouse; 1 ng/mL; 6 h) can promote the proliferation of thyroid epithelial cells in in vitro mouse thyroid tissues[3].
IGF-I/IGF-1 Protein (Mouse; 10 nM; 1 h) does not affect the level of PKCδ in H9C2 cells[4].

Biological Activity

1.The ED50 is <10 ng/mL as measured by FDC-P1 cells, corresponding to a specific activity of >1 × 105 units/mg.
2.Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 9.164 ng/mL. corresponding to a specific activity is 1.03×105 units/mg.

  • Measured in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is 9.164 ng/mL. corresponding to a specific activity is 1.03×105 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P05017-1 (G49-A118)

Gene ID
Molecular Construction
N-term
IGF1 (G49-A118)
Accession # P05017-1
C-term
Synonyms
rMuIGF-1; IGF-IA; Somatamedin C; MGF; IGF-I
AA Sequence

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Molecular Weight

Approximately 8 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IGF-I/IGF-1 Protein, Mouse Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGF-I/IGF-1 Protein, Mouse
Cat. No.:
HY-P7070
Quantity:
MCE Japan Authorized Agent: