IL-12 Protein, Mouse (HEK293)

IL-12 protein is a immune-suppressive heterodimeric cytokine, composed by IL-12A subunit (IL-12p35) and IL-12B subunit (IL-12p40), is naturally produced by dendritic cells^[1]. IL-12 exerts functions to activate and link the innate and acquired immune responses^[2]. IL-12 Protein, Mouse is produced in HEK293 cells, with total length of 506 amino acids and tag free.

IL-12 is primarily produced by professional antigen-presenting cells (APCs) such as B-cells and dendritic cells (DCs) as well as macrophages and granulocytes and regulates T-cell and natural killer-cell responses^[2].
IL-12 belongs to the family of interleukin-12, the only heterodimeric cytokines, including IL-12, IL-23, IL-27 and IL-35^[3].
IL-12 acts function by binding a receptor composed of IL12R1 and IL12R2 subunits, and results in the rapid tyrosine phosphorylation of a number of cellular substrates including the JAK family kinases TYK2 and JAK2^[4].
IL-12 is an important factor for the differentiation of naive T cells into T-helper type 1 CD4+ lymphocytes secreting interferon-gamma^[5].
IL-12 induces the production of interferon-gamma (IFN-gamma), favors the differentiation of T-helper 1 (Th1) cells and is an important link between innate resistance and adaptive immunity^[2].

Measured in a cell proliferation assay using CTLL-2 cells. The ED₅₀ for this effect is 0.004776 ng/mL, corresponding to a specific activity is 2.09×10⁸ units/mg.

• 
  Measured in a cell proliferation assay using CTLL-2 cells. The ED₅₀ for this effect is 0.004776 ng/mL, corresponding to a specific activity is 2.09×10₈ units/mg.

Mouse

HEK293

Tag Free

P43431 (R23-A215) & P43432 (M23-S335)

16159  [NCBI]&16160  [NCBI]

RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
&:
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

20-25&38-45 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kaliński P, et al. IL-12-deficient dendritic cells, generated in the presence of prostaglandin E2, promote type 2 cytokine production in maturing human naive T helper cells. J Immunol. 1997 Jul 1;159(1):28-35.  [Content Brief]

  [2]. Wolf SF, et al. Interleukin 12: a key modulator of immune function. Stem Cells. 1994 Mar;12(2):154-68.  [Content Brief]

  [3]. Mattner F, et al. Genetically resistant mice lacking interleukin-12 are susceptible to infection with Leishmania major and mount a polarized Th2 cell response. Eur J Immunol. 1996 Jul;26(7):1553-9.  [Content Brief]

  [4]. Vignali DA, et al. IL-12 family cytokines: immunological playmakers. Nat Immunol. 2012 Jul 19;13(8):722-8.  [Content Brief]

  [5]. Bacon CM, et al. Interleukin 12 (IL-12) induces tyrosine phosphorylation of JAK2 and TYK2: differential use of Janus family tyrosine kinases by IL-2 and IL-12. J Exp Med. 1995 Jan 1;181(1):399-404.  [Content Brief]

  [6]. Cua DJ, et al. Interleukin-23 rather than interleukin-12 is the critical cytokine for autoimmune inflammation of the brain. Nature. 2003 Feb 13;421(6924):744-8.  [Content Brief]