IL-17F Protein, Cynomolgus (HEK293, His)

IL-17F is an inflammatory homodimeric cytokine that induces many proinflammatory cytokines and chemokines. IL-17F also induces antimicrobial peptides. IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer^[1][2]. IL-17F Protein, Cynomolgus (HEK293, His) is a recombinant cynomolgus IL-17F protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 133 amino acids (R31-Q163).

Interleukin-17F (IL-17F) belongs to the IL-17 cytokine family. IL-17F is expressed in activated CD4 T cells, activated monocytes, basophils and mast cells. IL-17F can be produced by differentiated TH17 cells, lamina propria T cells, memory CD4⁺ T cells, γδ T cells and NKT cells^[1].
The cynomolgus IL-17F shares 93.87% amino acid sequence identity with human and 57.14% identity with mouse.
IL-17F is an inflammatory cytokine that induces many proinflammatory cytokines and chemokines, including TGF-β, IL-2, ICAM1, GM-CSF, CCL2, CCL7, TSLP, MMP13, IL-6 and CXCL1. IL-17F also induces antimicrobial peptides including hBD-2, S100A7, S100A8 and S100A9 with IL-22 and can synergize with IL-23 in human eosinophils to promote the production of IL-1β and IL-6. IL-17F is a homodimeric cytokine. IL-17F shares the most similarities with IL-17A (50% homology) and can be produced as an IL-17AF heterodimer. IL-17A, IL-17F and IL-17A/F use the same receptor complex: IL-17RA and IL-17RC heterodimer. They trigger qualitatively similar signaling pathways, and IL-17F exhibits the lowest biological activity. IL-17F shows about 100–1000 times lower affinity to the IL-17RA subunit than IL-17A, and does not compete with IL-17A binding to IL-17RA^[1][2].
IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer^[1][3][4].

Cynomolgus

HEK293

C-6*His

G7P4V0 (R31-Q163)

102118959  [NCBI]

RKIPKVGHTFFQKPESCPPVPEGSMKLDTGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCKHLGCINAQGKEDISMNSVPIQQETLVLRRKHQGCSVSFQLEKVLVTVGCTCVTPVVHHVQ

19-22 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Chang SH, et al. IL-17F: regulation, signaling and function in inflammation. Cytokine. 2009 Apr;46(1):7-11.  [Content Brief]

  [2]. McGeachy MJ, et al. The IL-17 Family of Cytokines in Health and Disease. Immunity. 2019 Apr 16;50(4):892-906.  [Content Brief]

  [3]. Ferreira N, et al. IL-17A and IL-17F orchestrate macrophages to promote lung cancer. Cell Oncol (Dordr). 2020 Aug;43(4):643-654.  [Content Brief]

  [4]. Tong Z, et al. A protective role by interleukin-17F in colon tumorigenesis. PLoS One. 2012;7(4):e34959.  [Content Brief]