1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17 Receptor
  5. IL-17RB
  6. IL-17RB Protein, Human (HEK293, His)

IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers. IL-17RB Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers[1][2]. IL-17RB Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags.

Background

IL-17RB (Interleukin 17 receptor B), a 47.9 kDa transmembrane protein (462 aa) that belongs to the IL-17 receptor family, and can be activated by IL-17B. It has been proved to be involved in inflammatory diseases and cancers. IL-17RB is expressed in various endocrine tissues and in epithelial cells in different organs such as kidney and liver and mucosal tissues[1][2][3].
The amino acid sequence of human IL-17RB protein has low homology with mouse IL-17B protein.
IL-17RB has a SEFIR cytoplasmic domain implicated in homotypic dimerization and recruitment of signaling proteins (shared with IL-17RA) and a TRAF6-binding domain (not found in IL-17RA). IL-17B shares its receptor IL-17RB with IL-17E (also known as IL-25) that binds to the heterodimeric IL-17RA/IL-17RB complex. The binding affinity (KD) of IL-17B for IL-17RB is around 30-fold lower than that of IL-17E. It does not bind IL-17, IL-17C and IL-17F. Interleukin-17 (IL-17) plays a pivotal role in inflammatory diseases and cancers. IL-17 acts its role through IL-17 receptor (IL-17R). The IL-17R family are single transmembrane proteins that include the subtype receptors of IL-17RA to IL-17RE. Upon ligand binding, IL-17RB activates the canonical NK-κB pathway as well as ERK, JNK, and p38. Moreover, TRAF6 binds to IL-17RB independently of its ligand and participates in IL-17RB-dependent NF-κB activation[1][2][3].
It is reported that IL-17RB expression is significantly increased in gastric cancer tissues. Moreover, overexpression of IL-17RB is strongly associated with metastasis and inversely correlates with progression-free survival in pancreatic cancer. IL-17RB can enhance thyroid cancer cell invasion and metastasis via ERK1/2 pathway-mediated MMP-9 expression[1]. By using a rodent ortholog of IL-17BR as a probe, IL-17BR message was found to be drastically up-regulated during intestinal inflammation elicited by indomethacin treatment in rats[2]. IL-17RB expression in human innate type 2 lymphocytes, natural killer T (NKT) cells, and Th2 cells suggests a potential role in immune cells[3].

In Vitro

IL-17RB Protein, Human (10 μg/mL; 72 hours) preincubated with IL-2 plus IL-25 for 30 min before addition to the PBMC cultures, the result shows IL-17RB inhibits IL-5 production[4].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9NRM6-1 (R18-G289)

Gene ID
Synonyms
Interleukin-17 receptor B; IL-17RB; IL-17Rh1; IL-17B receptor; CRL4; EVI27
AA Sequence

REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGG

Molecular Weight

38-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IL-17RB Protein, Human (HEK293, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17RB Protein, Human (HEK293, His)
Cat. No.:
HY-P72581
Quantity:
MCE Japan Authorized Agent: