1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-18
  5. IL-18 Protein, Rat

IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN)-γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-18 Protein, Rat

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN)-γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.

Background

Interleukin (IL)-18 is a potent stimulator of immunity and augments the severity of type II collagen-induced arthritis (CIA) in rats and mice by enhancing T helper 1 (Th1) cell activation, which increases the production of proinflammatory cytokines and arthritogenic antibodies. IL-18 possesses immunoregulatory activities, including the stimulation of interferon (IFN)-g production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation[1].

Biological Activity

1.The ED50 is <2 μg/mL resulted in the secretion of 0.15 ng/mL hIFN-gamma as measured by KG-1 cells, corresponding to a specific activity of >500 units/mg.
2.Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells. The ED50 for this effect is 0.055 μg/mL, corresponding to a specific activity is 1.818×10^4 U/mg.

  • Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells. The ED50 for this effect is 0.055 μg/mL, corresponding to a specific activity is 1.818×104 U/mg.
Species

Rat

Source

E. coli

Tag

Tag Free

Accession

P97636-1 (H37-S194)

Gene ID
Molecular Construction
N-term
IL-18 (H37-S194)
Accession # P97636-1
C-term
Synonyms
rRtIL-18; Interferon-gamma-inducing factor; IL-1 gamma
AA Sequence

HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

Molecular Weight

Approximately 18.4 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 50 mM NaCl, pH 8.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-18 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-18 Protein, Rat
Cat. No.:
HY-P7210
Quantity:
MCE Japan Authorized Agent: