1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-27
  5. IL-27 Protein, Human (CHO, His)

IL-27 (Interleukin-27) is a heterodimeric cytokine of the IL-12 family, composed of two subunits, EBI3 (Epstein-Barr-virus-induced molecule 3) and p28. IL-27 enhances the development, proliferation, and cytotoxic activity of CD8+ T cells, thereby indirectly promoting anti-tumor immunity[ 2]. IL-27 Protein, Human (CHO, His) is a recombinant protein with a His label that consists of two subunits, EBI3 (IL27B) (229 amino acids (M1-K229)) and IL27A (214 amino acids (F29-P243)), is produced by CHO cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
20 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-27 (Interleukin-27) is a heterodimeric cytokine of the IL-12 family, composed of two subunits, EBI3 (Epstein-Barr-virus-induced molecule 3) and p28[1]. IL-27 enhances the development, proliferation, and cytotoxic activity of CD8+ T cells, thereby indirectly promoting anti-tumor immunity[ 2]. IL-27 Protein, Human (CHO, His) is a recombinant protein with a His label that consists of two subunits, EBI3 (IL27B) (229 amino acids (M1-K229)) and IL27A (214 amino acids (F29-P243)), is produced by CHO cells.

Background

IL-27 is mainly produced by cells of myeloid origin such as monocytes, macrophages, dendritic cells, and microglial cells, in response to stimuli acting through Toll-like receptors or TNF-R-family members[3].
The amino acid sequence of human IL-27 protein has low homology for mouse IL-27 protein.
IL-27 acts through a heterodimer receptor consisting of IL-27Rα (WSX1) and gp130 chains, activates the JAK/STAT signaling pathway, which mainly involves STAT1 and STAT3 phosphorylation. STAT3 activation by IL-27 induces the expression of SOCS3, which inhibits further IL-27 signaling in a negative feedback loop, through inhibition of JAK activity[3].
IL-27 plays multiple roles in proinflammatory and anti-inflammatory immune responses. IL-27 enhances NF-κB/AP-1 activity and increases IL-12p40, TNF-α, and IL-6 production, increases TLR4 and TLR5 expression[5]. IL-27 exerts inhibitory effects upon hPMSC adherence and proliferation, and promotes migration of hPMSCs. Besides, IL-27 can upregulate PDL1 expression and enhance the regulatory effects of hPMSCs on Th1 and Th2 cell differentiations and IL-10 secretion from CD4+T cells[6]. IL-27 induces the proliferation and differentiation in hematopoietic stem cells[7]. IL-27 increases IL-10 levels and the expression of p-STAT1, p-STAT3[8]. IL-27 promotes the development and differentiation of CD4+IL-10+ T cells[9].

In Vitro

IL-27 (human) (5 ng/mL; 24 h) enhances LPS-induced IL-12p4, TNF-α, and IL-6 production in THP-1 and PMA-THP-1 cells[5].
IL-27 (human) (5 ng/mL; 16 h) increases TLR4 and TLR5 expression in monocytes and macrophages[5].
IL-27 (human) (2, 3 ng/mL; 6, 12, 24 h) significantly inhibits cell proliferation, adherence and promotes migration in hPMSCs, increases IL-1 secretion from CD4+T cells, and upregulates PDL1 expression via the JAK/STAT1 pathway[6].
IL-27 (human) (.1, 1, 1, 1 ng/mL; 9 days) enhances proliferation and differentiation of human CD34+ cells[7].

Biological Activity

1. Measured by its binding ability in a functional ELISA. Immobilized human IL27-His at 10 μg/mL (100 μl/well) can bind human IL27RA-Fc, The EC50 of human IL27RA-Fc is 0.2-0.46 μg/mL.
2. Measured in antiviral assays using HepG2 cells infected with vesicular stomatitisvirus(VSV). The ED50 for this effect is typically ≤92 ng/mL.

Species

Human

Source

CHO

Tag

C-His

Accession

Q14213 (R21-K229)&Q8NEV9 (F29-P243)

Gene ID
Synonyms
Interleukin-27 subunit beta; IL-27B; Ebi3; Interleukin-27 subunit alpha; IL-27A; p28
AA Sequence

RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
&:
FPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP

Molecular Weight

Approximately 56 kDa

Purity

Greater than 87% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM MOPS,150 mM NaCl, 0.05% CHAPS, PH7.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-27 Protein, Human (CHO, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-27 Protein, Human (CHO, His)
Cat. No.:
HY-P73199
Quantity:
MCE Japan Authorized Agent: