IL-4 Protein, Rhesus macaque

IL-4 protein actively engages in B-cell activation, serving as a costimulator for DNA synthesis, inducing class II MHC molecule expression, and enhancing IgE and IgG1 secretion. It regulates CD23 expression on lymphocytes and monocytes, positively influences IL31RA expression in macrophages, and induces autophagy in dendritic cells through mTORC1 signaling interference and RUFY4 induction. IL-4 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived IL-4 protein, expressed by E. coli , with tag free.

IL-4 protein actively participates in various B-cell activation processes and other cell types, acting as a costimulator of DNA synthesis. Moreover, it induces the expression of class II MHC molecules on resting B-cells and enhances the secretion and cell surface expression of IgE and IgG1. IL-4 also plays a regulatory role in the expression of the low affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Additionally, it positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

The ED₅₀ as determined by a cell proliferation assay using human TF-1 cells is less than 1.0 ng/mL, corresponding to a specific activity of >1.0x10⁶ IU/mg.

• 
  Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.2042 ng/mL, corresponding to a specific activity is 4.897×10⁶ U/mg

Rhesus Macaque

E. coli

Tag Free

P51492 (H25-S153)

574281  [NCBI]

HNCHIALREIIETLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLEDFLERLKTIMREKYSKCSS

Approximately 14.9 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of 2 xPBS, 5 % Trehalose, pH 7.4 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.