LIF Protein, Rat (HEK293, His)

Lif Protein, a cytokine, plays a vital role in cell proliferation, differentiation, and immune response regulation. Dysregulation of Lif Protein has been linked to various diseases, including cancer and inflammatory disorders. Targeting Lif Protein may offer potential therapeutic interventions in these conditions by modulating cell growth, promoting immune regulation, and suppressing inflammation. LIF Protein, Rat (HEK293, His) is the recombinant rat-derived LIF protein, expressed by HEK293 , with C-6*His labeled tag.

Integrin alpha-2/beta-1, also known as ITGA2 protein, functions as a receptor for various extracellular matrix molecules including laminin, collagen, collagen C-propeptides, fibronectin, and E-cadherin. It specifically recognizes the proline-hydroxylated sequence G-F-P-G-E-R in collagen. This integrin plays a crucial role in mediating the adhesion of platelets and other cells to collagens. Additionally, it modulates the expression of collagen and collagenase genes, generates mechanical forces, and organizes newly synthesized extracellular matrix. In the context of microbial infection, the ITGA2:ITGB1 complex acts as a receptor for Human rotavirus A.

Measured in a cell proliferation assay using M-NFS-60 cells. The ED₅₀ for this effect is 0.2365 ng/mL, corresponding to a specific activity is 4.23×10^6 units/mg.

• 
  Measured in a cell proliferation assay using M-NFS-60 cells. The ED₅₀ for this effect is 0.2365 ng/mL, corresponding to a specific activity is 4.23×10⁶ units/mg.

Rat

HEK293

C-6*His

P17777 (S23-F202)

60584  [NCBI]

SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF

30-55 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.