2. Peptides
  3. Peptide and Derivatives
  4. Hormones and Neuropeptides Inhibitors and Substrates
  5. Adrenocorticotropic Hormone (ACTH) (1-39), human

Adrenocorticotropic Hormone (ACTH) (1-39), human  (Synonyms: 1-39-Corticotropin (human))

Cat. No.: HY-P1211 Purity: 99.09%
SDS COA Handling Instructions

Molarity Calculator

Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenocorticotropic Hormone (ACTH) (1-39), human Chemical Structure

Adrenocorticotropic Hormone (ACTH) (1-39), human Chemical Structure

CAS No. : 12279-41-3

Size Price Stock Quantity
5 mg USD 160 In-stock
10 mg USD 260 In-stock
25 mg USD 550 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Adrenocorticotropic Hormone (ACTH) (1-39), human:

Adrenocorticotropic Hormone (ACTH) (1-39), human Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.

IC50 & Target

Melanocortin receptor[1]
In Vitro

Adrenocorticotropic Hormone (ACTH) (1-39), human (ACTH 1-39), a member of the melanocortin family, stimulates production of CS by the adrenals, but melanocortin receptors are also found in the central nervous system (CNS) and on immune cells. ACTH 1-39 protects neurons in vitro from several apoptotic, excitotoxic and inflammation-related insults[1].
The conditioned medium (CM) is prepared from untreated astroglia (AS) cultures and from AS cultures treated with 200 nM ACTH 1-39 for 24 h, washed to remove ACTH 1-39, then incubated for another 24 h in DMEM. In initial experiments, no difference is found in oligodendroglia (OL) viability in the presence of OL definedmediumwith 2% newborn calf serum (NCS) or AS CM (prepared in DMEM with no serum). After 24 h, OL death under each condition varies between 1 and 4%. Similar results for OL viability are obtained with microglia (MG) CM. In subsequent experiments, controls in each experiment consist of OL in defined medium with 2% NCS[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Adrenocorticotropic Hormone (ACTH) (1-39), human Related Antibodies
Molecular Weight

4541.14

Formula

C207H308N56O58S
CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
Sequence Shortening

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

H2O : ≥ 50 mg/mL (11.01 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2202 mL 1.1010 mL 2.2021 mL
5 mM 0.0440 mL 0.2202 mL 0.4404 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo:

For the following dissolution methods, please prepare the working solution directly. It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

  • Protocol 1

    Add each solvent one by one:  PBS

    Solubility: 100 mg/mL (22.02 mM); Clear solution; Need ultrasonic

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
Cell Assay
[2]

For analysis of the effects of ACTH 1-39 or CM on oligodendroglia (OL) death, purified OL cultures are incubated with ACTH 1-39 at 200 nM or the various CM for 30 min before addition of the toxic agents. Cell death is assessed after 1 day using trypan blue uptake as the indicator of cell death. Trypan blue is considered a preferred method for measurement of total cell death compared to terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL), which measures only apoptosis, or live/dead fluorescent assays, which may not detect permeable dead cells with degraded DNA, thus underestimating cell death. Differentiated OL are identified by their characteristicmorphology, that is, rounded or oval birefringent cells with multiple lacy branching processes, and in some cases by immunostaining with antibodies to galactolipids[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2202 mL 1.1010 mL 2.2021 mL 5.5052 mL
5 mM 0.0440 mL 0.2202 mL 0.4404 mL 1.1010 mL
10 mM 0.0220 mL 0.1101 mL 0.2202 mL 0.5505 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Adrenocorticotropic Hormone (ACTH) (1-39), human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Adrenocorticotropic Hormone (ACTH) (1-39), human12279-41-31-39-Corticotropin (human)OthersInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenocorticotropic Hormone (ACTH) (1-39), human
Cat. No.:
HY-P1211
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (557 KB) Français - FR (557 KB) Deutsch - DE (557 KB) Norwegian - NO (557 KB) Español - ES (557 KB) Swedish - SV (557 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.