OMGP Protein, Mouse (HEK293, His)

OMGP protein is a cell adhesion molecule that plays a crucial role in the interactive process necessary for myelination in the central nervous system.It accomplishes this by binding to RTN4R, facilitating the formation and maintenance of myelin sheaths.OMGP Protein, Mouse (HEK293, His) is the recombinant mouse-derived OMGP protein, expressed by HEK293 , with C-His labeled tag.

OMGP Protein, a membrane-associated protein, is involved in regulating axonal growth and neural development. It interacts with Nogo receptors, inhibiting axonal regeneration. OMGP Protein's role in neural plasticity makes it a potential target for therapeutic interventions aimed at promoting nerve regeneration and functional recovery in neurological disorders and injuries.

Measured by its ability to inhibit proliferation of SH-SY5Y cells. The ED₅₀ for this effect is 4.59 μg/mL, corresponding to a specific activity is 217.865 units/mg.

• 
  Measured by its ability to inhibit proliferation of SH-SY5Y cells. The ED₅₀ for this effect is 4.59 μg/mL, corresponding to a specific activity is 217.865 units/mg.

Mouse

HEK293

C-6*His

Q63912 (I25-T245)

18377  [NCBI]

ICPLQCTCTERHRHVDCSGRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQEITLHNNRWSCDHKQNITYLLKWVMET

Approximately 40-52 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.