1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Serine/Threonine Kinase Proteins
  4. p21-Activated Kinase 1
  5. PAK1 Protein, Human (His-SUMO)

PAK1 is a dynamic protein kinase that plays an important role in multiple intracellular signaling pathways, affecting cytoskeletal dynamics, adhesion, migration, proliferation, apoptosis, mitosis, and vesicle trafficking. Multifunctional PAK1 directly phosphorylates BAD to provide antiapoptotic cell protection. PAK1 Protein, Human (His-SUMO) is the recombinant human-derived PAK1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PAK1 is a dynamic protein kinase that plays an important role in multiple intracellular signaling pathways, affecting cytoskeletal dynamics, adhesion, migration, proliferation, apoptosis, mitosis, and vesicle trafficking. Multifunctional PAK1 directly phosphorylates BAD to provide antiapoptotic cell protection. PAK1 Protein, Human (His-SUMO) is the recombinant human-derived PAK1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

PAK1, a dynamic protein kinase, intricately participates in diverse intracellular signaling pathways downstream of integrins and receptor-type kinases. Its multifaceted roles encompass crucial involvement in cytoskeleton dynamics, cell adhesion, migration, proliferation, apoptosis, mitosis, and vesicle-mediated transport processes. Demonstrating versatility, PAK1 directly phosphorylates BAD, providing cellular protection against apoptosis. Activation is achieved through interaction with CDC42 and RAC1, establishing its position as a GTPase effector that bridges Rho-related GTPases to the JNK MAP kinase pathway. PAK1's reach extends to the phosphorylation and activation of MAP2K1, orchestrating downstream MAP kinase activation. In addition to steering the reorganization of the actin cytoskeleton, actin stress fibers, and focal adhesion complexes, PAK1 also influences tubulin chaperone TBCB, impacting microtubule biogenesis and organization. Noteworthy roles include regulation of insulin secretion in response to elevated glucose levels, participation in the neuromuscular junction formation, and inhibition of activity during apoptosis. PAK1's vast repertoire extends to phosphorylating RAF1, SNAI1, MYL9/MLC2, and contributing to various cellular functions, such as chemokine uptake, synaptic stability, dendritic spine formation, and microtubule nucleation. Its involvement in mediating gastric cancer cell migration, response to DNA damage, and facilitation of stress granules underscore the complexity of PAK1's cellular impact.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q13153-1 (M1-H545)

Gene ID
Molecular Construction
N-term
6*His-SUMO
PAK1 (M1-H545)
Accession # Q13153-1
C-term
Synonyms
Serine/threonine-protein kinase PAK 1; Alpha-PAK; p21-activated kinase 1 ; p65-PAK; PAK1
AA Sequence

MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH

Molecular Weight

Approximately 76.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PAK1 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PAK1 Protein, Human (His-SUMO)
Cat. No.:
HY-P71530
Quantity:
MCE Japan Authorized Agent: