1. Recombinant Proteins
  2. Others
  3. PD-1 Protein, Canine (HEK293, C-His)

The Angiopoietin-1 Protein is a secreted glycoprotein that is a key ligand in the vascular tyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells. PD-1 Protein, Canine (HEK293, C-His) is the recombinant canine-derived PD-1, expressed by HEK293 , with C-6*His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Angiopoietin-1 Protein is a secreted glycoprotein that is a key ligand in the vascular tyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells. PD-1 Protein, Canine (HEK293, C-His) is the recombinant canine-derived PD-1, expressed by HEK293 , with C-6*His labeled tag. ,

Background

ANGPT1 encodes a secreted glycoprotein in the angiopoietin family and is a key ligand in the vasotyrosine kinase signaling pathway. ANGPT1 stimulates angiogenesis by activating PTK2/FAK and downstream kinase MAPK1/ERK2 and MAPK3/ERK1 signaling pathways. The Angiopoietin-1 Protein regulates the formation and stability of blood vessels and plays an important role in vascular development. ANGPT1 affects the proliferation, migration and differentiation of skeletal muscle cells[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Canine PD-1 is present at 0.5 μg/mL can bind Recombinant Canine PD-L1. The ED50 for this effect is 5.43 μg/mL.

Species

Canine

Source

HEK293

Tag

C-6*His

Accession

XP_543338.3 (L25-L169)

Gene ID

486213

Synonyms
CD279; hPD-1; PDCD1; Programmed cell death 1; SLEB2
AA Sequence

LDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVMRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQGL

Molecular Weight

Approximately 31-40 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PD-1 Protein, Canine (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-1 Protein, Canine (HEK293, C-His)
Cat. No.:
HY-P73342A
Quantity:
MCE Japan Authorized Agent: