1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. PD-1
  5. PD-1 Protein, Mouse (HEK293, His)

PD-1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P70640
SDS COA Handling Instructions

The PD-1 protein is expressed on antigen-activated T cells and can induce and maintain immune tolerance to itself.PD-1 binds to CD274/PDCD1L1 and CD273/PDCD1LG2, transmits inhibitory signals, inhibits T cell activation and regulates immune responses.PD-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $30 In-stock
10 μg $45 In-stock
50 μg $125 In-stock
100 μg $200 In-stock
500 μg $435 In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PD-1 protein is expressed on antigen-activated T cells and can induce and maintain immune tolerance to itself.PD-1 binds to CD274/PDCD1L1 and CD273/PDCD1LG2, transmits inhibitory signals, inhibits T cell activation and regulates immune responses.PD-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

PD-1, an inhibitory receptor expressed on antigen-activated T-cells, plays a crucial role in the induction and maintenance of immune tolerance to self. Upon binding to ligands like CD274/PDCD1L1 and CD273/PDCD1LG2, PD-1 delivers inhibitory signals, suppressing T-cell activation and contributing to the regulation of immune responses. Following T-cell receptor engagement, PD-1 associates with CD3-TCR in the immunological synapse, directly inhibiting T-cell activation. The inhibitory effects involve the recruitment of PTPN11/SHP-2, which dephosphorylates key signaling molecules proximal to the TCR. Exploited by tumors, the PD-1-mediated inhibitory pathway serves to attenuate anti-tumor immunity and promote tumor survival. PD-1 exists as a monomer and interacts with CD274/PDCD1L1 and CD273/PDCD1LG2, while interaction with FBXO38 leads to ubiquitination and proteasomal degradation.

Biological Activity

Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED50 for this effect is 0.7591-0.986 μg/mL, corresponding to a specific activity is 1.31-1.01×103units/mg.

  • Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625ng/mL of bound hPD-L1. The ED50 for this effect is 0.986 μg/mL, corresponding to a specific activity is 1.01×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q02242 (L25-Q167)

Gene ID
Molecular Construction
N-term
PD-1 (L25-Q167)
Accession # Q02242
6*His
C-term
Synonyms
Programmed cell death protein 1; PD-1; CD279; Pdcd1; mPD-1
AA Sequence

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

Molecular Weight

Approximately 25-43 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70640
Quantity:
MCE Japan Authorized Agent: