1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. PD-1
  5. PD-1 Protein, Human (143a.a, HEK293, His)

PD-1 Protein, Human (143a.a, HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE PD-1 Protein, Human (143a.a, HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PD-1 Protein, Human (143a.a, HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Background

Programmed death-1 (PD-1) is a receptor on T cells that has been shown to suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2. When PD-1 expressing T cells contact cells expressing its ligands, functional activities in response to antigenic stimuli, including proliferation, cytokine secretion, and cytotoxicity are reduced[1].

Biological Activity

1. Measured by its binding ability in a functional ELISA.2 µg/mL (100 µL/well) of immoblized recombinant human PD-1-His can bind human PD-L1-Fc with a linear range of 24-600 ng/mL.
2. Measured by its ability to inhibit proliferation of HT-29 cells. The ED50 this effect is 0.1452 μg/mL, corresponding to a specific activity is 6.89×103 units/mg

  • Measured by its ability to inhibit proliferation of HT-29 cells. The ED50 this effect is 0.1452 μg/mL, corresponding to a specific activity is 6.89×103 units/mg
Species

Human

Source

HEK293

Tag

C-His

Accession

Q15116 (L25-Q167)

Gene ID
Molecular Construction
N-term
PD-1 (L25-Q167)
Accession # Q15116
His
C-term
Synonyms
rHuPD-1, His; PD1; CD279; PDCD1
AA Sequence

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

Molecular Weight

30-42 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 5% trehalose and mannitol or 20 mM PB, 150 mM NaCl, pH 7.4 or 50 mM MOPS, 500 mM NaCl, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-1 Protein, Human (143a.a, HEK293, His)
Cat. No.:
HY-P7396
Quantity:
MCE Japan Authorized Agent: