PD-1 Protein, Human (143a.a, HEK293, His)

PD-1 Protein, Human (143a.a, HEK293, His) suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2.

Programmed death-1 (PD-1) is a receptor on T cells that has been shown to suppress activating signals from the T cell receptor when bound by either of its ligands, programmed death-ligand 1 (PD-L1) or PD-L2. When PD-1 expressing T cells contact cells expressing its ligands, functional activities in response to antigenic stimuli, including proliferation, cytokine secretion, and cytotoxicity are reduced^[1].

1. Measured by its binding ability in a functional ELISA.2 µg/mL (100 µL/well) of immoblized recombinant human PD-1-His can bind human PD-L1-Fc with a linear range of 24-600 ng/mL.
2. Measured by its ability to inhibit proliferation of HT-29 cells. The ED₅₀ this effect is 0.1452 μg/mL, corresponding to a specific activity is 6.89×10³ units/mg

• 
  Measured by its ability to inhibit proliferation of HT-29 cells. The ED₅₀ this effect is 0.1452 μg/mL, corresponding to a specific activity is 6.89×10³ units/mg

Human

HEK293

C-His

Q15116 (L25-Q167)

5133  [NCBI]

LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH

30-42 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 5% trehalose and mannitol or 20 mM PB, 150 mM NaCl, pH 7.4 or 50 mM MOPS, 500 mM NaCl, pH 7.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Syn NL, et al. De-novo and acquired resistance to immune checkpoint targeting. Lancet Oncol. 2017 Dec;18(12):e731-e741.  [Content Brief]