1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. SDF-1/CXCL12
  6. CXCL12/SDF-1 alpha
  7. SDF-1 alpha/CXCL12 Protein, Human

The SDF-1 alpha/CXCL12 protein is a chemoattractant for immune cells. SDF-1 alpha/CXCL12 Protein, Human is the recombinant human-derived SDF-1 alpha/CXCL12 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg USD 52 In-stock
10 μg USD 135 In-stock
50 μg USD 350 In-stock
100 μg USD 560 Get quote
250 μg USD 890 In-stock
500 μg USD 1250 In-stock
1 mg USD 1750 In-stock
> 1 mg   Get quote  

Get it by June 3 for select sizes. Order within 10 hrs 38 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE SDF-1 alpha/CXCL12 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SDF-1 alpha/CXCL12 protein is a chemoattractant for immune cells. SDF-1 alpha/CXCL12 Protein, Human is the recombinant human-derived SDF-1 alpha/CXCL12 protein, expressed by E. coli , with tag free.

Background

SDF-1 alpha/CXCL12 protein functions as a chemoattractant with specific activity on T-lymphocytes and monocytes, excluding neutrophils. Upon activation of the C-X-C chemokine receptor CXCR4, it induces a rapid and transient rise in intracellular calcium ions, facilitating chemotaxis. SDF-1-beta(3-72) and SDF-1-alpha(3-67) exhibit reduced chemotactic activity, and binding to cell surface proteoglycans appears to inhibit the formation of SDF-1-alpha(3-67), preserving activity at local sites. Additionally, it binds to the atypical chemokine receptor ACKR3, activating the beta-arrestin pathway and serving as a scavenger receptor for SDF-1. Through binding to the allosteric site (site 2) of integrins, it activates ITGAV:ITGB3, ITGA4:ITGB1, and ITGA5:ITGB1 independently of CXCR4. Acting as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase, SDF-1 alpha/CXCL12 stimulates migration of monocytes and T-lymphocytes through CXCR4 and ACKR3, decreasing monocyte adherence to ICAM-1-coated surfaces, a ligand for beta-2 integrins. The SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1-mediated adhesion of monocytes to ICAM-1 through LYN kinase. It inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1, plays a protective role after myocardial infarction, and induces down-regulation and internalization of ACKR3 in various cells. Essential during embryonic development, it is required for B-cell lymphopoiesis, myelopoiesis in bone marrow, and heart ventricular septum formation. Furthermore, SDF-1 alpha/CXCL12 stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7, as well as the growth of stromal cell-dependent pre-B-cells (By similarity). Existing in monomeric or homodimeric forms, the equilibrium is influenced by non-acidic pH, multivalent anions, and binding to CXCR4 or heparin. The monomeric form is vital for full chemotactic activity and resistance to ischemia/reperfusion injury, while the dimeric form acts as a partial agonist of CXCR4, stimulating Ca2+ mobilization without chemotactic activity, serving instead as a selective antagonist that blocks chemotaxis induced by the monomeric form. SDF-1 alpha/CXCL12 interacts with the N-terminus of ACKR3, integrin subunit ITGB3 (via the allosteric site (site 2)), and TNFAIP6 via the Link domain.

Biological Activity

1. Full biological activity determined by a chemotaxis bioassay using PHA and rHuIL-2 activated human peripheral blood T-lymphocytes is in a concentration range of 20-80 ng/mL.
2. Measured by its ability to chemoattract IL-2-activated human T cells. The ED50 for this effect is approximately ≤45.17 ng/mL, corresponding to a specific activity is ≥2.214×104 U/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P48061-2 (K22-K89)

Gene ID
Molecular Construction
N-term
CXCL12 (K22-K89)
Accession # P48061-2
C-term
Synonyms
Stromal Cell-Derived Factor 1; SDF-1; hSDF-1; C-X-C Motif Chemokine 12; Intercrine Reduced in Hepatomas; IRH; hIRH; Pre-B Cell Growth-Stimulating Factor; PBSF; CXCL12; SDF1; SDF1A; SDF1B
AA Sequence

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Molecular Weight

Approximately 8-10.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or 20 mM PB, 130 mM NaCl, pH 7.3.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SDF-1 alpha/CXCL12 Protein, Human
Cat. No.:
HY-P70469
Quantity:
MCE Japan Authorized Agent: