ST2/IL1RL1 Protein, Human (310a.a, HEK293, His)

ST2/IL1RL1 Protein potently inhibits IL-33 signaling. ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) is the recombinant human-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag. The total length of ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) is 310 a.a., with molecular weight of 52-60 kDa.

ST2/IL1RL1 protein serves as a potent inhibitor of IL-33 signaling.

1.Measured in a cell proliferation assay using A549 cells. The ED₅₀ for this effect is 0.7922 ng/mL in the presence of 10 ng/mL recombinant mouse IL-33, corresponding to a specific activity is 1.2623×10⁶ units/mg.
2.Measured by its ability to bind human IL33 in functional Elisa.

• 
  Measured in a cell proliferation assay using A549 cells. The ED₅₀ for this effect is 0.7922 ng/mL in the presence of 10 ng/mL recombinant mouse IL-33, corresponding to a specific activity is 1.2623×10⁶ units/mg.

Human

HEK293

C-His

Q01638-2 (K19-F328)

9173  [NCBI]

KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF

52-60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.