SUMO2 Protein, Human (His)

Small ubiquitin-related modifier 2 (SUMO2) is a ubiquitin-like protein that covalently attached to proteins as part of post-translational modification system. SUMO2 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, DNA replication and repair, mitosis, signal transduction and protein stability. SUMO2 Protein, Human (His) is the recombinant human-derived SUMO2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SUMO2 Protein, Human (His) is 93 a.a., with molecular weight of ~17.0 kDa.

Small ubiquitin-related modifier 2 (SUMO2) is a member of the SUMO protein family. SUMO2 is a ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer as part of post-translational modification system. SUMO2 is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, DNA replication and repair, mitosis, signal transduction and protein stability. SUMO2 is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. SUMO2 also plays a role in the regulation of sumoylation status of SETX.

Human

E. coli

N-6*His

AAH08450.1 (M1-G93)

6613  [NCBI]

MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Approximately 17.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.