TMED9 Protein, Human (HEK293, His)

TMED9, a key player in vesicular protein trafficking, operates prominently in the early secretory pathway, specifically in COPI vesicle-mediated retrograde transport. It facilitates coatomer recruitment to membranes, enhances ARFGAP2 activity, and ensures specific retention of p24 complexes in cis-Golgi membranes, notably influencing TMED2 and TMED10 localization. Beyond retrograde transport, TMED9 contributes to intracellular membrane organization, including the ER-Golgi intermediate compartment and Golgi apparatus, and participates in PTPN2 isoform PTPB ER localization. TMED9's dynamic oligomeric states involve monomers and homodimers, influenced by its interactions with EMP24/GP25L family members (TMED2, TMED7, and TMED10) and specific associations with TMED5, COPG1, PTPN2, SPAST, and STX17. TMED9 Protein, Human (HEK293, His) is the recombinant human-derived TMED9 protein, expressed by HEK293, with C-His labeled tag. The total length of TMED9 Protein, Human (HEK293, His) is 165 a.a., with molecular weight of ~20.8 kDa.

TMED9, a protein intricately involved in vesicular protein trafficking, predominantly operates within the early secretory pathway, particularly in COPI vesicle-mediated retrograde transport, facilitating coatomer recruitment to membranes. It enhances the coatomer-dependent activity of ARFGAP2 and plays a pivotal role in the specific retention of p24 complexes in cis-Golgi membranes, contributing notably to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. Beyond its involvement in retrograde transport, TMED9 is implicated in the organization of intracellular membranes, including the ER-Golgi intermediate compartment and the Golgi apparatus. It further participates in the ER localization of PTPN2 isoform PTPB. TMED9 exhibits a dynamic oligomeric state, existing as a monomer and homodimer in the endoplasmic reticulum, with a predominantly monomeric state in the endoplasmic reticulum-Golgi intermediate compartment and cis-Golgi network. Oligomerization likely occurs with other members of the EMP24/GP25L family, such as TMED2, TMED7, and TMED10. Additionally, TMED9 engages in specific interactions with TMED5, COPG1, PTPN2, SPAST, and STX17, underscoring its multifaceted involvement in intracellular processes.

Measured in a cell proliferation assay using MCF-7 cells. The ED₅₀ for this effect is 19.86 ng/mL. Corresponding to a specific activity is 5.035×10⁴ Unit/mg.

Human

HEK293

C-His

Q9BVK6/NP_059980.2 (L38-R202)

54732  [NCBI]

LYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQR

Approximately 20.8 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.