1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TSLP Protein, Human (HEK293, His-Myc)

TSLP Protein, Human (HEK293, His-Myc)

Cat. No.: HY-P700601
Handling Instructions

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (HEK293, His-Myc) is the recombinant human-derived TSLP protein, expressed by HEK293 , with N-Myc, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c(+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (HEK293, His-Myc) is the recombinant human-derived TSLP protein, expressed by HEK293 , with N-Myc, N-6*His labeled tag.

Background

The TSLP protein is a cytokine that stimulates the release of T-cell-attracting chemokines from monocytes, with a particular effect on enhancing the maturation of CD11c(+) dendritic cells. Additionally, this protein can directly activate mast cells, potentially leading to the induction of allergic inflammation. It is also suggested that TSLP may have antimicrobial properties in the oral cavity and on the skin.

Species

Human

Source

HEK293

Tag

N-Myc;N-6*His

Accession

Q969D9-1 (Y29-Q159)

Gene ID
Molecular Construction
N-term
6*His-Myc
TSLP (Y29-Q159)
Accession # Q969D9-1
C-term
Synonyms
Thymic stromal lymphopoietin; Thymic stromal lymphopoietin protein TSLP; Tslp; TSLP protein; TSLP_HUMAN
AA Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Molecular Weight

18.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TSLP Protein, Human (HEK293, His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TSLP Protein, Human (HEK293, His-Myc)
Cat. No.:
HY-P700601
Quantity:
MCE Japan Authorized Agent: