1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. UEV-1
  6. UBE2V1 Protein, Human (His)

The UBE2V1 protein does not have intrinsic ubiquitin ligase activity and can cooperate with UBE2N to synthesize non-canonical polyubiquitin chains linked through Lys-63. This type of polyubiquitination activates IKK and mediates NF-kappa-B activation, thereby affecting transcriptional activation, cell cycle progression, and DNA repair. UBE2V1 Protein, Human (His) is the recombinant human-derived UBE2V1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of UBE2V1 Protein, Human (His) is 146 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UBE2V1 protein does not have intrinsic ubiquitin ligase activity and can cooperate with UBE2N to synthesize non-canonical polyubiquitin chains linked through Lys-63. This type of polyubiquitination activates IKK and mediates NF-kappa-B activation, thereby affecting transcriptional activation, cell cycle progression, and DNA repair. UBE2V1 Protein, Human (His) is the recombinant human-derived UBE2V1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of UBE2V1 Protein, Human (His) is 146 a.a., with molecular weight of ~17.0 kDa.

Background

The UBE2V1 protein, on its own, lacks ubiquitin ligase activity. However, when forming a heterodimer with UBE2N, it catalyzes the synthesis of non-canonical poly-ubiquitin chains linked through Lys-63. This type of poly-ubiquitination activates IKK and does not involve protein degradation by the proteasome. UBE2V1 plays a crucial role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6, and TRAF2, contributing to the transcriptional activation of target genes. Additionally, it participates in cell cycle progression, differentiation, and the error-free DNA repair pathway, enhancing cell survival after DNA damage. Furthermore, UBE2V1 promotes TRIM5 capsid-specific restriction activity, collaborating with UBE2N to generate 'Lys-63'-linked polyubiquitin chains that activate the MAP3K7/TAK1 complex, leading to the induction of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UBE2N, UBE2V1 catalyzes viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIGI, activating the downstream signaling pathway for interferon beta production. In association with TRAF3IP2 E3 ubiquitin ligase, UBE2V1-UBE2N mediates 'Lys-63'-linked polyubiquitination of TRAF6 in the IL17A-mediated signaling pathway. It forms a heterodimer with UBE2N and interacts with various proteins, including STUB1 and TRAF6, contributing to diverse cellular processes and signaling pathways.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q13404 (A2-N147)

Gene ID
Molecular Construction
N-term
UBE2V1 (A2-N147)
Accession # Q13404
6*His
C-term
Synonyms
Ubiquitin-Conjugating Enzyme E2 Variant 1; UEV-1; CROC-1; TRAF6-Regulated IKK Activator 1 Beta Uev1A; UBE2V1; CROC1; UBE2V; UEV1; P/OKcl.19
AA Sequence

AATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

UBE2V1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2V1 Protein, Human (His)
Cat. No.:
HY-P71410
Quantity:
MCE Japan Authorized Agent: