2. Recombinant Proteins
  3. Ubiquitin Related Proteins
  4. Deubiquitinase
  5. UCH Proteins
  6. UCH-L3
  7. UCHL3 Protein, Mouse (His, solution)

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is involved in the regulation of cellular processes and protein degradation. It is particularly expressed in the testes and plays a vital role in spermatogenesis. UCHL3 Protein's significance in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Mouse (His, solution) is the recombinant mouse-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 60 In-stock
10 μg USD 100 In-stock
50 μg USD 295 In-stock
100 μg   Get quote  

Get it by June 3 for select sizes. Order within 0 hrs 17 mins.

or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is involved in the regulation of cellular processes and protein degradation. It is particularly expressed in the testes and plays a vital role in spermatogenesis. UCHL3 Protein's significance in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Mouse (His, solution) is the recombinant mouse-derived UCHL3 protein, expressed by E. coli , with N-His labeled tag.
Background

UCHL3 Protein is a deubiquitinating enzyme (DUB) that plays a crucial role in controlling the levels of cellular ubiquitin by processing ubiquitin precursors and ubiquitinated proteins. As a thiol protease, it specifically recognizes and hydrolyzes the peptide bond at the C-terminal glycine of ubiquitin or NEDD8. UCHL3 Protein exhibits a preference for 'Lys-48'-linked ubiquitin chains and has a 10-fold preference for Arg and Lys at position P3''. Its deubiquitinating activity includes the deubiquitination of ENAC in apical compartments, regulating the recycling of the apical membrane. Additionally, UCHL3 Protein indirectly enhances the phosphorylation of IGFIR, AKT, and FOXO1, thereby promoting insulin signaling and insulin-induced adipogenesis. It is also essential for stress-response retinal, skeletal muscle, and germ cell maintenance. Furthermore, UCHL3 Protein may be involved in working memory and can hydrolyze UBB(+1), a mutated form of ubiquitin that is resistant to degradation by the proteasome.
Species

Mouse
Source

E. coli
Tag

N-His
Accession

Q9JKB1 (E2-A230)
Gene ID

50933
Molecular Construction
N-term
His
UCHL3 (E2-A230)
Accession # Q9JKB1
C-term
Synonyms
UCH-L3; Ubiquitin thioesterase L3; Uchl3
AA Sequence

EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Weight

Approximately 26 kDa
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution
Formulation

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 20% Glycerol, pH 7.4.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

N/A.
Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.
Documentation
Data Sheet (236 KB) SDS (251 KB)

COA (205 KB)

Handling Instructions (2659 KB)

UCHL3 Protein, Mouse (His, solution) Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UCHL3 Protein, Mouse (His, solution)
Cat. No.:
HY-P76119A
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (251 KB) Français - FR (251 KB) Deutsch - DE (251 KB) Norwegian - NO (251 KB) Español - ES (251 KB) Swedish - SV (251 KB) Italian - IT (251 KB) Portuguese - PT (251 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.