VISTA/B7-H5 Protein, Mouse (HEK293, Fc)

VISTA/B7-H5 Protein is a type I transmembrane protein expressed primarily in white blood cells that inhibits T cell function. VISTA/B7-H5 Protein promotes embryonic stem cell differentiation by inhibiting BMP4 signaling and stimulates MMP14 mediated MMP2 activation. VISTA/B7-H5 Protein is highly expressed in tumors. VISTA/B7-H5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived VISTA/B7-H5 protein, expressed by HEK293 , with C-hFc labeled tag.

VISTA is a type I transmembrane protein that functions as an immune checkpoint. VISTA is a member of the B7 family and is mainly expressed in white blood cells, whose transcription is partially controlled by p53. VISTA can act as a ligand and receptor of T cells, inhibit T cell effector function, and maintain peripheral tolerance. VISTA promotes embryonic stem cell differentiation by inhibiting BMP4 signaling. VISTA stimulates MMP14 mediated MMP2 activation. VISTA is produced at high levels in tumor-infiltrating lymphocytes, and blocking VISTA with antibodies led to delayed tumor growth in mouse models of melanoma and squamous cell carcinoma. Increased VISTA levels were associated with increased immune activation and a decrease in CD4-positive T cells^{[1][2][3][4][5][6]}.

Mouse

HEK293

C-hFc

Q9D659 (F33-A194)

74048  [NCBI]

FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALA

60-68 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.