Search Result

Results for "

CCR1 antagonist

" in MedChemExpress (MCE) Product Catalog:

By Targets:	CCR (26) HIV (1)
By Research Areas:	Endocrinology (13) Infection (1) Inflammation/Immunology (23) Neurological Disease (3)

Inhibitors & Agonists

Peptides

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-124759

CCR1 antagonist 9	CCR	Inflammation/Immunology
CCR1 antagonist 9 is a potent and selective *CCR1* antagonist with an IC₅₀ of 6.8 nM in calcium flux assay .

HY-120588

BI 639667 CCR1 antagonist 8	CCR	Inflammation/Immunology Endocrinology
BI 639667 (compound 19n), a third azaindazole series compound, is a *CCR1* antagonist, with an IC₅₀ of 1.8 nM in Ca ²⁺ flux assay .

HY-12080A

BX471 hydrochloride 10+ Cited Publications ZK-811752 hydrochloride	CCR	Inflammation/Immunology Endocrinology
BX471 hydrochloride (ZK-811752 hydrochloride) is a potent, selective non-peptide *CCR1* antagonist with K_i of 1 nM for human CCR1, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.

HY-124668

CCR1 antagonist 12	CCR	Inflammation/Immunology
CCR1 antagonist 12 (Compound 12) is an antagonist for *CCR1* with IC₅₀ of 3 nM for human CCR1. CCR1 antagonist 12 inhibits CCL3-induced transwell chemotaxis with an IC₅₀ of 0.009 µM. CCR1 antagonist 12 exhibits good pharmacokinetic characters in rats model .

HY-114194

CCR1 antagonist 7	CCR	Inflammation/Immunology Endocrinology
CCR1 antagonist 7 (compound 16r) is a chemokine receptor 1 (CCR1) antagonist, with an IC₅₀ of 4 nM .

HY-114193

CCR1 antagonist 6	CCR	Inflammation/Immunology Endocrinology
CCR1 antagonist 6 (compound 16q) is a chemokine receptor 1 (CCR1) antagonist, with an IC₅₀ of 3 nM .

HY-15544

CCR1 antagonist 10	CCR	Inflammation/Immunology
CCR1 antagonist 10 (example 1) is a potent and orally active *CCR1* antagonist. CCR1 antagonist 10 inhibits ¹²⁵I-MIP-1α binding to THP-1 cell membranes with an K_i value of 2.3 nM .

HY-114097A

CCR1 antagonist 11 hydrochloride	CCR	Inflammation/Immunology
CCR1 antagonist 11 hydrochloride (A1B1) is an orally active *CCR1* antagonist with the IC₅₀ values of 0.03 μM, 0.58 μM and 0.32 μM for hCCR1, mCCR1 and rCCR1, respectively. CCR1 antagonist 11 hydrochloride can be used in the study of rheumatoid arthritis and other related inflammatory diseases .

HY-12079

CP-481715	CCR	Inflammation/Immunology
CP-481715 is a potent, reversible and selective *CCR1* antagonist with a K_d of 9.2 nM for human CCR1. CP-481715 is >100-fold selective for CCR1 as compared with a panel of G-protein-coupled receptors including related chemokine receptors. CP-481715 has the potential for rheumatoid arthritis and other inflammatory diseases research .

HY-103360A

cis-J-113863 UCB35625	CCR	Inflammation/Immunology
cis-J-113863 is a competitive chemokine receptor 1 (CCR1) antagonist, with IC₅₀ values of 0.9 and 5.8 nM for human and mouse CCR1 receptors, respectively .

HY-U00350

CCX354 1 Publications Verification	CCR	Inflammation/Immunology Endocrinology
CCX354 is an antagonist of *CCR1*, with anti-inflammatory activity.

HY-12080

BX471 10+ Cited Publications ZK-811752	CCR	Inflammation/Immunology Endocrinology
BX471 (ZK-811752) is an orally active, potent and selective non-peptide *CCR1* antagonist with a K_i of 1 nM, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.

HY-18611

RS102895 hydrochloride 15+ Cited Publications	CCR	Neurological Disease Endocrinology
RS102895 hydrochloride is a potent *CCR2* antagonist, with an IC₅₀ of 360 nM, and shows no effect on CCR1.

HY-18611A

RS102895 15+ Cited Publications	CCR	Neurological Disease Endocrinology
RS102895 is a potent *CCR2* antagonist, with an IC₅₀ of 360 nM, and shows no effect on CCR1.

HY-15546

BMS-817399	CCR	Inflammation/Immunology
BMS-817399 is a potent, selective, and orally bioavailable *CCR1* antagonist. BMS-817399 exhibits CCR1 binding affinity and chemotaxis inhibition potencies of 1 and 6 nM (IC₅₀), respectively. BMS-817399 can be used for the research of rheumatoid arthritis .

HY-103360B

trans-J-113863	CCR	Inflammation/Immunology
trans-J-113863 is a potent chemokine *CCR1* and *CCR3* receptor antagonist, and inhibits MIP-1α-induced chemotaxis in CCR1 transfectants and eotaxin-induced chemotaxis in CCR3 transfectants with IC₅₀ of 9.57 and 93.8 nM,respectively .

HY-111037

BMS-457	CCR	Inflammation/Immunology
BMS-457 is a potent and selective *CCR1* antagonist. BMS-457 can be used in the study of rheumatoid arthritis .

HY-15545

AZD-4818	CCR	Neurological Disease Inflammation/Immunology Endocrinology
AZD-4818 is a potent antagonist of chemokine *CCR1*. AZD-4818 can be used for researching chronic obstructive pulmonary disease (COPD) .

HY-103360

J-113863 3 Publications Verification	CCR	Inflammation/Immunology
J-113863 is a potent and selective *CCR1* antagonist with IC₅₀ values of 0.9 nM and 5.8 nM for human and mouse *CCR1* receptors, respectively. J-113863 is also a potent antagonist of the human *CCR3* (IC₅₀ of 0.58 nM) , but a weak antagonist of the mouse *CCR3* (IC₅₀ of 460 nM). J-113863 is inactive against CCR2, CCR4 and CCR5, as well as the LTB4 or TNF-α receptors. Anti-inflammatory effect .

HY-15418

RS 504393 Maximum Cited Publications 20 Publications Verification	CCR	Inflammation/Immunology Endocrinology
RS 504393 is a selective *CCR2* chemokine receptor antagonist (IC₅₀ values are 89 nM and > 100 μM for inhibition of human recombinant CCR2 and CCR1 receptors respectively).

HY-148232

BAY-3153	CCR	Inflammation/Immunology
BAY-3153 is a selective *CCR1* (C-C motif chemokine receptor 1) antagonist (human IC₅₀=3 nM; rat IC₅₀=11 nM; mice IC₅₀=81 nM) .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for *CCR1* and *CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀* of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-P4191A

Met-RANTES (human) (acetate)	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for *CCR1* and *CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀* of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-15724

Vercirnon 3 Publications Verification GSK-1605786; CCX282-B; Traficet-EN	CCR	Inflammation/Immunology Endocrinology
Vercirnon (GSK1605786A) is an orally bioavailable, selective, and potent antagonist of *CCR9. Vercirnon inhibits CCR9-mediated Ca ²⁺ mobilization and chemotaxis on Molt-4 cells with IC₅₀* values of 5.4 and 3.4 nM, respectively. Vercirnon is selective for CCR9 over CCR1-12 and CX3CR1-7 (IC₅₀s>10 µM for all). Vercirnon is an equipotent inhibitor of CCL25-directed chemotaxis of both splice forms of CCR9 (CCR9A and CCR9B) with IC₅₀ values of 2.8 and 2.6 nM, respectively .

HY-15724A

Vercirnon sodium 3 Publications Verification GSK-1605786 sodium; CCX282-B sodium; Traficet-EN sodium	CCR	Inflammation/Immunology Endocrinology
Vercirnon (GSK1605786A) sodium is an orally bioavailable, selective, and potent antagonist of *CCR9. Vercirnon sodium inhibits CCR9-mediated Ca ²⁺ mobilization and chemotaxis on Molt-4 cells with IC₅₀* values of 5.4 and 3.4 nM, respectively. Vercirnon sodium is selective for CCR9 over CCR1-12 and CX3CR1-7 (IC₅₀s>10 μM for all). Vercirnon sodium is an equipotent inhibitor of CCL25-directed chemotaxis of both splice forms of CCR9 (CCR9A and CCR9B) with IC₅₀ values of 2.8 and 2.6 nM, respectively .

HY-19974

TAK-220 2 Publications Verification	CCR HIV	Infection Endocrinology
TAK-220 is a selective and orally bioavailable *CCR5* antagonist, with IC₅₀s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC₅₀s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC₉₀s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.

Cat. No.	Product Name	Target	Research Area

HY-P4191A

Met-RANTES (human) (acetate)	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for *CCR1* and *CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀* of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for *CCR1* and *CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀* of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

Name
Email *

	Sorry, but the email address you supplied was invalid.