Tat-beclin 1 TFA 

Tat-beclin 1 TFA, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 TFA decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV)^[1].

Tat-beclin 1 TFA (10, 30, 50 μM; 24 hours) induces autophagy and results in a dose-dependent decrease in amounts of p62, a selective autophagy substrate, and a dose-dependent conversion of the non-lipidated form of LC3, LC3-I, to the lipidated, autophagosome-associated form of LC3, LC3-II, in multiple cell lines and primary murine embryonic fibroblasts (MEFs)^[1].
Tat-beclin 1 TFA (10 μM; 2-4 hours post-infection) decreases the intracellular survival of L. monocytogenes in primary murine bone-marrow-derived macrophages (BMDMs)^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Tat-beclin 1 TFA (15 mg/kg; i.p.; daily; beginning 1 day post-infection for 20 days) can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice (6-week-old GFP-LC3 mice)^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3855.12

C₁₆₆H₂₅₂F₃N₅₇O₄₇

[YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT (TFA salt)]

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Sanae Shoji-Kawata, et al. Identification of a Candidate Therapeutic Autophagy-Inducing Peptide. Nature. 2013 Feb 14;494(7436):201-6.  [Content Brief]