2. Induced Disease Models Products Neuronal Signaling
  3. Nervous System Disease Models Amyloid-β
  4. Alzheimer's Disease Models
  5. β-Amyloid (1-42), (rat/mouse) TFA

β-Amyloid (1-42), (rat/mouse) TFA  (Synonyms: Amyloid β-peptide (1-42) (rat/mouse) TFA)

Cat. No.: HY-P1388A Purity: 99.26%
SDS COA Handling Instructions

Molarity Calculator

β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (1-42), (rat/mouse) TFA Chemical Structure

β-Amyloid (1-42), (rat/mouse) TFA Chemical Structure

Size Price Stock Quantity
500 μg USD 200 In-stock
1 mg USD 320 In-stock
5 mg USD 1200 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 2 publication(s) in Google Scholar

Other Forms of β-Amyloid (1-42), (rat/mouse) TFA:

β-Amyloid (1-42), (rat/mouse) TFA Related Antibodies

Top Publications Citing Use of Products

2 Publications Citing Use of MCE β-Amyloid (1-42), (rat/mouse) TFA

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

IC50 & Target

Amyloid-β[1]
In Vitro

β-Amyloid Aggregation Guidelines (Following is our recommended protocol. This protocol only provides a guideline, and should be modified according to your specific needs).
1. Solid Aβ peptide was dissolved in cold hexafluoro-2-propanol (HFIP). The peptide was incubated at room temperature for at least 1h to establish monomerization and randomization of structure.
2. The HFIP was removed by evaporation, and the resulting peptide was stored as a film at -20 or -80 °C.
3. The resulting film was dissolved in anhydrous DMSO at 5 mM and then diluted into the appropriate concentration and buffer (serum- and phenol red-free culture medium) with vortexing.
4. Next, the solution was aged 48h at 4-8 °C. The sample was then centrifuged at 14000g for 10 min at 4-8 °C; the soluble oligomers were in the supernatant. The supernatant was diluted 10-200-fold for experiments.
Methods vary depends on the downstream applications.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

β-Amyloid (1-42), (rat/mouse) TFA Related Antibodies
In Vivo

β-Amyloid (1-42), (rat/mouse) (TFA) can induce Alzheimer's disease[4].

Induction of Alzheimer's disease[4]
Background
Alzheimer’s disease (AD) is a progressive neurodegenerative disorder mainly characterized by the abnormal accumulation of β-amyloid (Aβ) peptide. The oligomeric form of the Aβ peptide as being the critical initiator of neurotoxicity in the AD pathogenesis[4].
Specific Mmodeling Methods
Rat: Wistar • male • adult, weighing 240-260 g
Administration: 1 μg/μL • Hippocampal injection • single dose
Note
(1) β-Amyloid (1-42) TFA needs to be processed into oligomers before use.
(2) β-Amyloid (1-42) TFA was injected bilaterally into the hippocampus of rat brain in a volume of 1.0 μL over a period of 0.1 μL/min using 1 μL Hamilton syringe.
Modeling Indicators
Indicator changes: Decreased the gene expression level of α7-nAChR and increased the mRNA expression of NMDA receptor 2A, and -2B subunits.
Behavior: β-Amyloid (1-42) TFA aggregates increased the retention time and altered the behavioral response in rats after 15 days of injection.
Correlated Product(s): β-Amyloid (1-42), (rat/mouse) (HY-P1388); β-Amyloid (1-40) (rat) (HY-P1387); β-Amyloid (1-40) TFA (HY-P0265A)
Opposite Product(s): /

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Molecular Weight

4418.02 (free acid)

Formula

C199H307N53O59S.xC2HF3O2
Appearance

Solid

Color

White to off-white

Sequence

Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
Sequence Shortening

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*The compound is unstable in solutions, freshly prepared is recommended.

Solvent & Solubility
In Vitro: 

DMSO : 55 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo:

Select the appropriate dissolution method based on your experimental animal and administration route.

For the following dissolution methods, please ensure to first prepare a clear stock solution using an In Vitro approach and then sequentially add co-solvents:
To ensure reliable experimental results, the clarified stock solution can be appropriately stored based on storage conditions. As for the working solution for in vivo experiments, it is recommended to prepare freshly and use it on the same day.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

  • Protocol 1

    Add each solvent one by one:  10% DMSO    90% Corn Oil

    Solubility: ≥ 2.5 mg/mL; Clear solution

    This protocol yields a clear solution of ≥ 2.5 mg/mL (saturation unknown). If the continuous dosing period exceeds half a month, please choose this protocol carefully.

    Taking 1 mL working solution as an example, add 100 μL DMSO stock solution (25.0 mg/mL) to 900 μL Corn oil, and mix evenly.

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Please enter your animal formula composition:
%
DMSO +
% 
+
%
Tween-80 +
%
Saline
Recommended: Keep the proportion of DMSO in working solution below 2% if your animal is weak.
The co-solvents required include: DMSO, . All of co-solvents are available by MedChemExpress (MCE). , Tween 80. All of co-solvents are available by MedChemExpress (MCE).
Calculation results:
Working solution concentration: mg/mL
Method for preparing stock solution: mg drug dissolved in μL  DMSO (Stock solution concentration: mg/mL).

*The compound is unstable in solutions, freshly prepared is recommended.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only. If necessary, please contact MedChemExpress (MCE).
Method for preparing in vivo working solution for animal experiments: Take μL DMSO stock solution, add μL . μL , mix evenly, next add μL Tween 80, mix evenly, then add μL Saline.
 If the continuous dosing period exceeds half a month, please choose this protocol carefully.
Please ensure that the stock solution in the first step is dissolved to a clear state, and add co-solvents in sequence. You can use ultrasonic heating (ultrasonic cleaner, recommended frequency 20-40 kHz), vortexing, etc. to assist dissolution.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

β-Amyloid (1-42), (rat/mouse) TFA Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

β-Amyloid (1-42), (rat/mouse)Amyloid β-peptide (1-42) (rat/mouse)Amyloid-ββ-amyloid peptideAβAbetaInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid (1-42), (rat/mouse) TFA
Cat. No.:
HY-P1388A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.