2. GPCR/G Protein Immunology/Inflammation
  3. CXCR
  4. CTCE-0214

CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

CTCE-0214 Chemical Structure

CTCE-0214 Chemical Structure

CAS No. : 577782-52-6

Size Price Stock Quantity
5 mg USD 270 In-stock
10 mg USD 420 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

CTCE-0214 Related Antibodies

Top Publications Citing Use of Products

View All CXCR Isoform Specific Products:

View All Isoforms
CXCR CXCR1 CXCR2 CXCR3 CXCR4 CXCR7 CXCR6

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research[1][2][3].

IC50 & Target[1]

SDF-1α-CXCR4

 

In Vitro

CTCE-0214 (0.01-0.1 ng/mL; 4 d) increases the expansion of CD34+ cells subsets[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

CTCE-0214 Related Antibodies
In Vivo

CTCE-0214 (intravenous injection; 1-25 mg/kg; once) treatment inhibits Lipopolysaccharide-induced plasma TNF-α production[1].
CTCE-0214 (intraperitoneal injection and intravenous injection; 25 mg/kg; once) decreases Zymosan-induced plasma TNF-α production[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male CD-1 mice injected with Lipopolysaccharide[1]
Dosage: 1, 10, or 25 mg/kg
Administration: Intravenous injection; 1, 10, or 25 mg/kg; once
Result: Decreased LPS-induced plasma TNF-α production in a dose dependent manor with a 93% reduction.
Showed no significant effect on LPS-induced plasma IL-6 and IL-10 production.
Animal Model: Zymosan-induced peritonitis mice model[1]
Dosage: 25 mg/kg
Administration: Intraperitoneal injection and intravenous injection; 25 mg/kg; once
Result: Showed a significant reduction in plasma TNF-α (53 reduction, p<0.05).
Molecular Weight

3554.11

Formula

C170H254N44O40
CAS No.
Appearance

Solid

Color

White to off-white

Sequence Shortening

KPVSLSYRAPFRFFGGGGLKWIQEYLEKALN-NH2 (Lactam:Lys20-Glu24)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (28.14 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2814 mL 1.4068 mL 2.8136 mL
5 mM 0.0563 mL 0.2814 mL 0.5627 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2814 mL 1.4068 mL 2.8136 mL 7.0341 mL
5 mM 0.0563 mL 0.2814 mL 0.5627 mL 1.4068 mL
10 mM 0.0281 mL 0.1407 mL 0.2814 mL 0.7034 mL
15 mM 0.0188 mL 0.0938 mL 0.1876 mL 0.4689 mL
20 mM 0.0141 mL 0.0703 mL 0.1407 mL 0.3517 mL
25 mM 0.0113 mL 0.0563 mL 0.1125 mL 0.2814 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

CTCE-0214 Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

CTCE-0214577782-52-6CTCE0214CTCE 0214CXCRCXC chemokine receptorsC-X-C motif chemokine receptorsanti-inflammatory activityinflammation sepsissystemic inflammatory syndromeCD34+Inhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTCE-0214
Cat. No.:
HY-P3612
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.