Animal-Free IL-17F Protein, Mouse (His)

IL-17F Protein, a cytokine belonging to the IL-17 family, is produced using recombinant DNA technology without the use of animal-derived materials. It is involved in inflammatory responses and immune regulation. IL-17F Protein offers a safe and ethical alternative for research and therapeutic applications, addressing concerns related to animal-based production methods. Animal-Free IL-17F Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17F protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

IL-17F is a cytokine that plays a role in host defense against extracellular bacteria and fungi. It induces neutrophilic inflammation and activates and recruits neutrophils to infection and inflammatory sites. IL-17F also stimulates the production of antimicrobial proteins by mucosal epithelial cells, limiting the entry of microbes through epithelial barriers. It signals through the IL-17RC homodimeric receptor complex, activating TRAF6 and NF-kappa-B signaling pathways. IL-17F also induces the transcriptional activation of IL33, a cytokine involved in pulmonary allergic response to fungi. It promotes sympathetic innervation of peripheral organs and regulates the composition of intestinal microbiota and immune tolerance. IL-17F forms homodimers and heterodimers with IL-17A and forms complexes with IL17RA and IL17RC receptors.

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <100 ng/mL.

Mouse

E. coli

C-His

Q7TNI7-1 (R29-A161)

257630  [NCBI]

MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

Approximately 15.82 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium citrate, pH 4.5, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.