Carboxypeptidase B2/CPB2 Protein, Rat (HEK293, His)

Carboxypeptidase B2 (CPB2) protein acts as an enzyme that cleaves C-terminal arginine or lysine residues from biologically active peptides, including kinins or anaphylatoxins circulating in the blood, thereby regulating their activity. Furthermore, CPB2 plays a key role in downregulating fibrinolysis by removing C-terminal lysine residues from fibrin that has been partially degraded by plasmin. Carboxypeptidase B2/CPB2 Protein, Rat (HEK293, His) is the recombinant rat-derived Carboxypeptidase B2/CPB2 protein, expressed by HEK293 , with C-His labeled tag.

CaCarboxypeptidase B2 (CPB2) plays a critical role in physiological regulation, particularly within the circulatory system. The enzyme exhibits specificity in cleaving C-terminal arginine or lysine residues from biologically active peptides, including kinins and anaphylatoxins, thereby finely tuning their activities and downstream signaling in the circulation. Additionally, CPB2 is instrumental in the down-regulation of fibrinolysis by selectively removing C-terminal lysine residues from fibrin that has undergone partial degradation by plasmin. This dual functionality underscores CPB2's pivotal role in maintaining the balance of peptide activities and coagulation processes, emphasizing its significance in orchestrating intricate regulatory mechanisms within the physiological context.

Specific activity is determined by a kinetic assay using Hippuryl-L-Arginine as substrate. One unit equals one micromole of Hippuryl-L-Arginine hyrolyzed per minute. Specific activity is reported in Units per milligram. This experiment requires the use of 1 mM substrate and incubation at room temperature for 30 minutes. The specific activity is 14 U/mg.

Rat

HEK293

C-10*His

Q9EQV9 (F22-S422)

113936  [NCBI]

FQSGHVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVNSVKAYLNASRIPFNVLMNNVEDLIQQQTSNDTVSPRASSSYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSYEKYPLYVLKVSGKEHRVKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENTYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSVHMNNRCVGTDLNRNFASKHWCEKGASSFSCSETYCGLYPESEPEVKAVADFLRRNINHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERFIKPTCAEALAAVSKIAWHVIRNS

Approximately 55-75 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.