2. Recombinant Proteins
  3. Immune Checkpoint Proteins CD Antigens
  4. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  5. CTLA-4 CTLA-4
  6. CTLA-4 Protein, Human (HEK293)

CTLA-4 Protein, Human (HEK293)

Cat. No.: HY-P72959
COA Handling Instructions

The CTLA-4 protein is a key inhibitory receptor and a major negative regulator of T cell responses in coordination of immune regulation. Its unique property is its significantly increased affinity for B7 ligands (CD80/CD86) compared with CD28. CTLA-4 Protein, Human (HEK293) is the recombinant human-derived CTLA-4 protein, expressed by HEK293 , with tag free. The total length of CTLA-4 Protein, Human (HEK293) is 126 a.a., with molecular weight of ~13.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $85 In-stock
50 μg $220 In-stock
100 μg $350 In-stock
> 100 μg   Get quote  
or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CTLA-4 protein is a key inhibitory receptor and a major negative regulator of T cell responses in coordination of immune regulation. Its unique property is its significantly increased affinity for B7 ligands (CD80/CD86) compared with CD28. CTLA-4 Protein, Human (HEK293) is the recombinant human-derived CTLA-4 protein, expressed by HEK293 , with tag free. The total length of CTLA-4 Protein, Human (HEK293) is 126 a.a., with molecular weight of ~13.5 kDa.
Background

GMP CTLA-4, a pivotal inhibitory receptor, emerges as a principal negative regulator orchestrating T-cell responses within the intricate framework of immune modulation. This regulatory function stems from the distinctive property of GMP CTLA-4, displaying significantly heightened affinity for its natural B7 family ligands, CD80 and CD86, compared to the cognate stimulatory coreceptor CD28. This pronounced difference in binding affinity positions GMP CTLA-4 to competitively engage with CD80/B7-1 and CD86/B7.2, exerting a suppressive influence on T-cell activation and finely tuning immune responses. The homodimeric structure of GMP CTLA-4, intricately linked by disulfide bonds, further underscores its role as a molecular sentinel in immune regulation. Additionally, GMP CTLA-4 interacts with ICOSLG, contributing to its multifaceted engagement in immune checkpoint pathways.
Species

Human
Source

HEK293
Tag

Tag Free
Accession

P16410 (K36-D161)
Gene ID
Molecular Construction
N-term
CTLA-4 (K36-D161)
Accession # P16410
C-term
Synonyms
Cytotoxic T-lymphocyte associated protein 4; CTLA4; CD152
AA Sequence

MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD

Molecular Weight

Approximately 13.5 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.
Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

N/A.
Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping

Shipping with dry ice.
Documentation

COA (220 KB)

Handling Instructions (2659 KB)

CTLA-4 Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTLA-4 Protein, Human (HEK293)
Cat. No.:
HY-P72959
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.