CTLA-4 Protein, Rat (HEK293, His)

CTLA-4 protein inhibits T-cell responses by binding strongly to CD80 and CD86 receptors, surpassing CD28. This affinity allows CTLA-4 to effectively regulate T-cell activation and immune responses. The balance between inhibitory and stimulatory signals controlled by CTLA-4 and its ligands modulates T-cell-mediated immune reactions. CTLA-4 Protein, Rat (HEK293, His) is the recombinant rat-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag. The total length of CTLA-4 Protein, Rat (HEK293, His) is 161 a.a., with molecular weight of 21-30 kDa.

CTLA-4 protein operates as a key inhibitory receptor, serving as a major negative regulator in T-cell responses. Its pivotal role lies in the potent affinity CTLA-4 exhibits for its natural B7 family ligands, CD80 and CD86, a binding strength surpassing that of their counterpart stimulatory coreceptor, CD28. This heightened affinity enables CTLA-4 to effectively temper T-cell activation, forming a crucial component of the regulatory mechanisms governing immune responses. The nuanced balance between inhibitory and stimulatory signals orchestrated by CTLA-4 and its ligands plays a central role in modulating the intensity and duration of T-cell-mediated immune reactions.

Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED₅₀ for this effect is 0.231 µg/mL when stimulated with 1 µg/mL Recombinant Human B7-1 in the presence of PHA, corresponding to a specific activity is 4.329×10³ U/mg.

• 
  Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED₅₀ for this effect is 0.231 µg/mL when stimulated with 1 µg/mL Recombinant Human B7-1 in the presence of PHA, corresponding to a specific activity is 4.329×10³ U/mg.

Rat

HEK293

C-6*His

Q62859 (E36-D161)

63835  [NCBI]

EAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Approximately 21-30 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.