Dectin-2/CLEC6A Protein, Mouse (HEK293, His)

Dectin-2/CLEC6A protein has carbohydrate binding and pattern recognition receptor activities, and is involved in the positive regulation of I-kappaB kinase/NF-kappaB signaling, immune response regulation, and fungal response. It is predicted to reside in membranes, particularly on the outside of the plasma membrane, and it is expressed in a variety of tissues, including bone marrow, embryos, lungs, spleen, and thymus. Dectin-2/CLEC6A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with C-6*His labeled tag.

Dectin-2/CLEC6A Protein exhibits carbohydrate binding activity and pattern recognition receptor activity, playing a role in various processes such as positive regulation of I-kappaB kinase/NF-kappaB signaling, immune response regulation, and response to fungus. It is predicted to be located in the membrane and serves as an integral component of the membrane, specifically the external side of the plasma membrane. Dectin-2/CLEC6A Protein is expressed in tissues including bone marrow, embryo, lung, spleen, and thymus. It is the orthologous counterpart to human CLEC6A gene. Notably, Dectin-2/CLEC6A Protein displays biased expression in liver E18 (RPKM 6.6), spleen adult (RPKM 5.8), and 13 other tissues.

Mouse

HEK293

C-6*His

Q9JKF4-1/NP_064385.1 (I44-L209)

56620  [NCBI]

IMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL

Approximately 23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.