1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Ephrin/Eph Family Cytokine Receptors
  4. Ephrins
  5. Ephrin-A5
  6. Ephrin-A5/EFNA5 Protein, Human (HEK293, His)

Ephrin-A5/EFNA5 Protein, a cell surface GPI-bound ligand, crucially interacts with Eph receptors, inducing bidirectional signaling and regulating adhesion, organization, and development in neurons, vasculature, and epithelium. It forms complexes with EPHA3, EPHA8, and ADAM10, impacting internalization and function, while also mediating communication in pancreatic islet cells and influencing brain development. Ephrin-A5/EFNA5 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A5/EFNA5 Protein, Human (HEK293, His) is 183 a.a., with molecular weight of ~27 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ephrin-A5/EFNA5 Protein, a cell surface GPI-bound ligand, crucially interacts with Eph receptors, inducing bidirectional signaling and regulating adhesion, organization, and development in neurons, vasculature, and epithelium. It forms complexes with EPHA3, EPHA8, and ADAM10, impacting internalization and function, while also mediating communication in pancreatic islet cells and influencing brain development. Ephrin-A5/EFNA5 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ephrin-A5/EFNA5 Protein, Human (HEK293, His) is 183 a.a., with molecular weight of ~27 kDa.

Background

Ephrin-A5/EFNA5 Protein is a cell surface GPI-bound ligand that plays a crucial role in neuronal, vascular, and epithelial development by interacting with Eph receptors, a family of receptor tyrosine kinases. This interaction leads to contact-dependent bidirectional signaling between adjacent cells. Ephrin-A5/EFNA5 induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to its cognate receptor, and this signaling requires the activity of the Fyn tyrosine kinase. It activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization, and it may also be involved in maintaining lens transparency and stimulating axon fasciculation. Furthermore, Ephrin-A5/EFNA5 mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion and modulates brain development by regulating cell-cell adhesion and repulsion through its interaction with EPHA7. Additionally, Ephrin-A5/EFNA5 binds to EPHB2 and interacts with EPHA8, activating the latter. It also forms a complex with EPHA2, EPHA3, and ADAM10, which regulates the shedding and internalization of Ephrin-A5/EFNA5, thereby influencing its function.

Species

Human

Source

HEK293

Tag

C-His

Accession

P52803 (Q21-N203)

Gene ID
Molecular Construction
N-term
EFNA5 (Q21-N203)
Accession # P52803
His
C-term
Synonyms
Ephrin-A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5; EPLG7
AA Sequence

MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Molecular Weight

Approximately 27 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ephrin-A5/EFNA5 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ephrin-A5/EFNA5 Protein, Human (HEK293, His)
Cat. No.:
HY-P73012
Quantity:
MCE Japan Authorized Agent: