GALNT2 Protein, Human (HEK293, His)

The GALNT2 protein catalyzes the initial steps in O-linked oligosaccharide biosynthesis by transferring N-acetyl-D-galactosamine to a protein receptor. GALNT2 Protein, Human (HEK293, His) is the recombinant human-derived GALNT2 protein, expressed by HEK293 , with N-His labeled tag. The total length of GALNT2 Protein, Human (HEK293, His) is 520 a.a., with molecular weight of 63 KDa, respectively.

GALNT2 protein serves as a key enzyme in O-linked oligosaccharide biosynthesis, initiating the process by transferring an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. This enzymatic activity exhibits a wide substrate spectrum, including peptides such as EA2, Muc5AC, Muc1a, and Muc1b. GALNT2 is implicated in the O-linked glycosylation of critical proteins, including the immunoglobulin A1 (IgA1) hinge region, APOC-III, ANGPTL3, and PLTP. Additionally, it plays a role in the regulation of high-density lipoprotein cholesterol (HDL-C) metabolism, contributing to the intricate processes governing lipid homeostasis.

Measured by its ability to transfer GalNAc from UDP-GalNAc to EA2 that incubate at 37°C for 20 min. The specific activity is 379.51 pmol/min/μg.

Human

HEK293

N-10*His

Q10471-1/NP_004472.1 (K52-Q571)

2590  [NCBI]

KKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ

Approximately 63 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 25 mM Tris, 150 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.