1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. GM-CSF
  5. GM-CSF Protein, Mouse

GM-CSF Protein, Mouse is a member of colony-stimulating factors which regulates proliferation, differentiation, and survival of hematopoietic cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

GM-CSF Protein, Mouse is a member of colony-stimulating factors which regulates proliferation, differentiation, and survival of hematopoietic cells.

Background

Granulocyte Macrophage Colony Stimulating Factor is a member of colony-stimulating factors which regulates proliferation, differentiation, and survival of hematopoietic cells including mature neutrophils, macrophages, and dendritic cells[1].

Biological Activity

1.The ED50 is <5 pg/mL as measured by murine FDC-P1 cells, corresponding to a specific activity of >2 × 107 units/mg.
2.Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED50 for this effect is ≤30 pg/mL, corresponding to a specific activity is ≥3.33×107 units/mg.
3.Mouse GM-CSF R alpha captured on CM5 Chip can bind Mouse GM-CSF with an affinity constant of 2.279 nM as determined in SPR assay.

  • Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED50 for this effect is 7.539 pg/mL, corresponding to a specific activity is 1.326×108 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q14AD9 (A18-K141)

Gene ID
Molecular Construction
N-term
GM-CSF (A18-K141)
Accession # Q14AD9
C-term
Synonyms
rMuGM-CSF; CSF-2; GM-CSF
AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Molecular Weight

Approximately 14-16 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS or 20 mM Tris-HCl, 1 mM EDTA, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

GM-CSF Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF Protein, Mouse
Cat. No.:
HY-P7361
Quantity:
MCE Japan Authorized Agent: