1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17 Receptor
  5. IL-17RC
  6. IL-17RC Protein, Human (HEK293, Fc)

IL-17RC Protein, Human (HEK293, Fc)

Cat. No.: HY-P72580
SDS COA Handling Instructions

IL-17RC (Interleukin 17 receptor C), a receptor for IL-17A and IL-17F, is a type I membrane glycoprotein. It is expressed on a variety of nonhematopoietic cell types, and plays a role in inflammatory diseases, including autoimmunity and certain cancers. IL-17RC associates with IL-17RA to form a signaling receptor complex for IL-17A and IL-17F.IL-17RC Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $40 In-stock
10 μg $65 In-stock
50 μg $180 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-17RC (Interleukin 17 receptor C), a receptor for IL-17A and IL-17F, is a type I membrane glycoprotein. It is expressed on a variety of nonhematopoietic cell types, and plays a role in inflammatory diseases, including autoimmunity and certain cancers. IL-17RC associates with IL-17RA to form a signaling receptor complex for IL-17A and IL-17F[1][2].IL-17RC Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag.

Background

IL-17RC, is the receptor for IL17A and IL17F homodimers as part of a heterodimeric complex with IL17RA. IL-17 cytokine family members IL-17A and IL-17F mediate inflammatory activities via the IL-17R complex, comprised of the IL-17RA and IL-17RC subunits. The expression profile and tissue distribution of IL-17RC suggest that the gene regulation of IL-17RC differs considerably from IL-17RA. Specifically, epithelial cells of the prostate, kidney, and joints express high levels of IL-17RC mRNA, while low levels of expression are detected in the hematopoietic cell compartments[1].
The amino acid sequence of human IL-17RC protein has low homology with mouse IL-17C protein. The differences between the human and murine systems extend to IL-17A and IL-17F cytokine binding affinities. hIL-17RA binds preferentially to IL-17A and has a relatively low binding affinity to IL-17F. In contrast, hIL-17RC binds IL-17A and IL-17F with the same affinity. In the murine system, the inverse is true: mIL-17RA binds IL-17A and IL-17F with equal affinities, but mIL-17RC binds preferentially to IL-17F. Therefore, in both humans and mice, IL-17RC appears to serve as a contact point for IL-17F[1].
The IL-17R subfamily includes IL-17RA, IL-17RB, IL-17RC, IL-17RD, and IL-17RE. The best-characterized IL-17R molecules are the IL-17RA and IL-17RC subunits, in part because of their interaction to form a receptor complex capable specific for IL-17A and IL-17F. IL-17RA co-immunoprecipitates with IL-17RC in a ligand-dependent manner, raising the possibility that the ligand-dependent loss of FRET between IL-17RA subunits results from oligomerization with IL-17RC. Consistent with this, IL-17RC also forms large, multimeric complexes consistent with oligomerization with IL-17RA. IL-17RC forms heterodimers with IL-17RA to mediate IL-17A and IL-17F signals in mouse stromal cells and human gastric adenocarcinoma AGS cells and synoviocytes. Although The IL-17RA and IL-17RC subunits operate in concert to mediate IL-17 signaling, IL-17RC possesses a number of features that differentiate it from IL-17RA. IL-17RC bears only 22% sequence homology with IL-17RA. Alignment against the human genome indicates that the il17rc gene contains 19 exons on chromosome 3 and spans 16,550 base pairs within the chromosomal region 3p25.3 to 3.24.1. The murine il17rc gene contains 18 exons on chromsome 6 and spans 11,565 base pairs on the chromosomal arm 6q. The full-length human IL-17RC (hIL-17RC) contains 720 amino acids, and the murine IL-17RC (mIL-17RC) contains 698 amino acids. In both species, il17rc encodes a single pass type I transmembrane protein where the transmembrane domain is encoded in exon 17[1][2].
The initial discovery of IL-17RC was based on its high levels of expression in human prostate cancer cells. Specific overexpression of IL-17RC protects prostate cancer cell lines from TNFα-induced apoptosis. IL-17RC also contributes to autoimmune disease pathogenesis. In rheumatoid arthritis (RA) models have high levels of IL-17A, IL-17F, IL-17RA, and IL-17RC in sera and inflamed synovium. Furthermore, based on RNAi blocking experiments, both IL-17RA and IL-17RC are required for the pro-inflammatory factors secreted by RA synoviocytes. The gene transcript analyses of psoriatic lesions revealed an impairment of IL-17RC mRNA expression. Perhaps this defect in IL-17RC expression leads to a compensatory effect, which could result in overactive Th17 cells and an inflammatory program[1][2].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human IL17 at 2 μg/mL (100 μl/well) can bind Human IL17RC hFc, the EC50 of Human IL17RC hFc is 200-800 ng/mL.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q8NAC3-3 (L21-A454)

Gene ID
Synonyms
Interleukin-17 receptor C; IL-17 receptor C; IL17RC; IL17Rhom; IL-17RL; ZcytoR14
AA Sequence

LERLVGPQDATHCSPGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPALPWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPSGCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWA

Molecular Weight

90-120 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

IL-17RC Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17RC Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72580
Quantity:
MCE Japan Authorized Agent: