IL-33 Protein, Human

IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

Human IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor activating NF-kappaB and MAP kinases. IL-33 induces production of Th2 cell related cytokines including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. The IL-33-ST2 signaling cascade plays some roles in the pathophysiology of chronic allergic conjunctivitis through the activation of mast cells^[1].

1.The ED₅₀ is <0.5 ng/mL as measured by D10S cells, corresponding to a specific activity of >2.0 × 10⁶ units/mg.
2.Measured by its binding ability in a functional ELISA, mmobilized Human IL-1RL1, Fc Tag at 5 μg/mL (100 μL/well) can bind Human IL-33. The ED₅₀ for this effect is 16.45 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. mmobilized Human IL-1RL1, Fc Tag at 5 μg/mL (100 μL/well) can bind Human IL-33,The ED₅₀ for this effect is 16.45 ng/mL.

Human

E. coli

Tag Free

O95760-1 (S112-T270)

90865  [NCBI]

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Approximately 18.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or 20 mM PB, 150 mM NaCl, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Matsuda A, et al. The role of interleukin-33 in chronic allergic conjunctivitis. Invest Ophthalmol Vis Sci. 2009 Oct;50(10):4646-52.  [Content Brief]