MKK6 Protein, Human (S207D, T211D, sf9, His)

Measured in a cell proliferation assay using Hep3B cells. The ED₅₀ for this effect is 77.27 ng/mL, corresponding to a specific activity is 1.29×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using Hep3B cells. The ED₅₀ for this effect is 77.27 ng/mL, corresponding to a specific activity is 1.29×10⁴ units/mg.

Human

Sf9 insect cells

N-6*His

P52564-1 (M1-D334, S207D, T211D)

5608

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDDVAKDIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Approximately 40 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 500 mM NaCl, pH 8.0, 10% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.