PSMA Protein, Human (HEK293, His, solution)

PSMA protein, with a preference for tri-alpha-glutamate peptides, acts as a folate hydrolase and NAALADase enzyme. It uptakes folate in the intestines, modulates excitatory neurotransmission by hydrolyzing NAAG to release glutamate in the brain, and exhibits dipeptidyl-peptidase IV type activity by cleaving Gly-Pro-AMC in vitro. PSMA Protein, Human (HEK293, His, solution) is the recombinant human-derived PSMA protein, expressed by HEK293 , with N-6*His labeled tag.

PSMA, a multifaceted enzyme, showcases both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activities, displaying a notable preference for tri-alpha-glutamate peptides. It plays a crucial role in the intestinal uptake of folate, contributing to essential metabolic processes. Within the brain, PSMA acts as a modulator of excitatory neurotransmission by hydrolyzing the neuropeptide N-acetylaspartylglutamate (NAAG), leading to the release of glutamate. Notably, PSMA's involvement in prostate tumor progression highlights its potential significance in cancer biology. Additionally, the enzyme exhibits dipeptidyl-peptidase IV type activity and effectively cleaves Gly-Pro-AMC in vitro, further emphasizing its diverse enzymatic functions.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

N-6*His

Q04609-1 (K44-A750)

2346  [NCBI]

KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

90-120 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, 5% Trehalose, pH 5.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.