2. Search Result
Search Result
Results for "

amino-acid peptide

" in MedChemExpress (MCE) Product Catalog:

29

Inhibitors & Agonists

31

Peptides

5

Natural
Products

Targets Recommended:
Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-P3581
    PE 22-28

    		Potassium Channel Neurological Disease
    PE 22-28 is a TREK-1 inhibitor with IC50 value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .
    PE 22-28
  • HY-P1856
    Proinsulin C-peptide (human)

    		Insulin Receptor Metabolic Disease
    Proinsulin C-peptide (human) is a 31-amino-acid peptide that links the A and B chains of proinsulin, ensuring its correct folding, which is biologically active and modulates cellular function .
    Proinsulin C-peptide (human)
  • HY-P2207
    Sinapultide

    		Biochemical Assay Reagents Others
    Sinapultide is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide can be used for synthetic phospholipids surfactants improvement .
    Sinapultide
  • HY-P2526
    LyP-1
    2 Publications Verification

    		 Complement System Cancer
    LyP-1 is a cyclic 9‐amino‐acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
    LyP-1
  • HY-P1511
    PACAP-Related Peptide (PRP), human

    		PACAP Receptor Neurological Disease
    PACAP-Related Peptide (PRP), human is a 29 amino-acid region of the PACAP precursor protein.
    PACAP-Related Peptide (PRP), human
  • HY-P0173
    Chlorotoxin(linear)

    		Chloride Channel Cancer
    Chlorotoxin(linear) is a linear 36 amino-acid peptide which can be used in Chlorotoxin related research.
    Chlorotoxin(linear)
  • HY-P2534
    C-Peptide 2, rat

    		Insulin Receptor Metabolic Disease
    C-Peptide 2, rat, 31-amino-acid peptide, is a component of proinsulin. C-Peptide 2, rat can inhibit glucose-induced insulin secretion .
    C-Peptide 2, rat
  • HY-P0173A
    Chlorotoxin

    		Chloride Channel Cancer
    Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
    Chlorotoxin
  • HY-P10814
    MciZ (B. subtilis)

    		Bacterial Infection
    MciZ (B. subtilis), a 40-amino-acid peptide, inhibits the GTPase activity of FtsZ that prevents inappropriate Z-ring formation during sporulation .
    MciZ (B. subtilis)
  • HY-P5354
    FRETS-VWF73

    		Fluorescent Dye Others
    FRETS-VWF73, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex=340 nm; Em=450 nm). .
    FRETS-VWF73
  • HY-P3811A
    Autocamtide-3 acetate

    		CaMK Neurological Disease
    Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
    Autocamtide-3 acetate
  • HY-P3811
    Autocamtide-3

    		CaMK Neurological Disease
    Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
    Autocamtide-3
  • HY-P2207A
    Sinapultide TFA

    		Biochemical Assay Reagents Others
    Sinapultide TFA is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide TFA can be used for synthetic phospholipids surfactants improvement .
    Sinapultide TFA
  • HY-P0285
    Rabies Virus Glycoprotein
    1 Publications Verification

    		 RABV Infection
    Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
    Rabies Virus Glycoprotein
  • HY-N5191
    Epidermin

    		Antibiotic Bacterial Infection
    Epidermin is a type A lantibiotic that is a tetracyclic 21-amino-acid peptide. Epidermin exhibits antibiotic activity against many Gram-positive bacteria. Epidermin has a role as a metabolite and an antibacterial agent .
    Epidermin
  • HY-P0285A
    Rabies Virus Glycoprotein TFA
    1 Publications Verification

    		 RABV Infection
    Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
    Rabies Virus Glycoprotein TFA
  • HY-P1714
    Apraglutide

    FE 203799

    		 GLP Receptor Metabolic Disease
    Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
    Apraglutide
  • HY-P10825
    p21PBP

    		DNA/RNA Synthesis Cancer
    p21PBP, a 20 amino-acid peptide, is an inhibitor of DNA replication. p21PBP specifically binds to purified proliferating cell nuclear antigen (PCNA) in tumour cell extracts. p21PBP is promising for research of cancers .
    p21PBP
  • HY-P1714A
    Apraglutide TFA

    FE 203799 TFA

    		 GLP Receptor Metabolic Disease
    Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
    Apraglutide TFA
  • HY-P2230
    Angstrom6

    A6 peptide

    		 PAI-1 Cancer
    Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling .
    Angstrom6
  • HY-P1293
    Conantokin G

    		iGluR Neurological Disease
    Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G has neuroprotective properties .
    Conantokin G
  • HY-P1293A
    Conantokin G TFA

    		iGluR Neurological Disease
    Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G TFA has neuroprotective properties .
    Conantokin G TFA
  • HY-P3431
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

    		iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-P4146
    Survodutide

    BI 456906

    		 GLP Receptor GCGR Metabolic Disease
    Survodutide (BI 456906) is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
    Survodutide
  • HY-P3431A
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

    		iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
  • HY-P1674A
    Murepavadin TFA
    2 Publications Verification

    POL7080 TFA

    		 Bacterial Antibiotic Infection
    Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC50 and MIC90 values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
    Murepavadin TFA
  • HY-P1674
    Murepavadin

    POL7080

    		 Bacterial Antibiotic Infection
    Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
    Murepavadin
  • HY-P4146A
    Survodutide TFA

    BI 456906 TFA

    		 GLP Receptor GCGR Metabolic Disease
    Survodutide (BI 456906) TFA is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide TFA, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide TFA has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
    Survodutide TFA
  • HY-P10827
    PIC1 PA

    		Complement System Inflammation/Immunology
    PIC1 PA, a 15 amino-acid peptide, is a potent PIC1 analog that inhibits classical pathway mediated complement activation. PIC1 PA functionally disrupts the C1s-C1r-C1r-C1s/MASPs interaction with collagen-like region (CLR) of C1q/MBL, respectively. PIC1 PA specifically binds to the CLR of C1q and bounds to purified C1q with a mean equilibrium dissociation constant (KD) of 33.3 nM .
    PIC1 PA

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: