TFF1 Protein, Human (HEK293, His)

TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human (HEK293, His) is the recombinant human-derived TFF1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TFF1 Protein, Human (HEK293, His) is 60 a.a., with molecular weight of ~8.1 kDa.

Trefoil Factor 1 (TFF1) protein acts as a stabilizer for the mucous gel that overlays the gastrointestinal mucosa, playing a crucial role in providing a robust physical barrier against a variety of noxious agents. By contributing to the integrity of the mucous layer, TFF1 aids in the protection and defense of the gastrointestinal tract from potential harmful substances. Its stabilizing function underscores its importance in maintaining the mucosal barrier, which is essential for the overall health and protection of the gastrointestinal mucosa.

Human

HEK293

C-6*His

P04155 (E25-F84)

7031  [NCBI]

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Approximately 8.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.