1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. GRO-gamma
  6. DCIP-1/CXCL3 Protein, Mouse (P.pastoris)

CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis. DCIP-1/CXCL3 Protein, Mouse (P.pastoris) is produced in P.pastoris , and consists of 73 amino acids (A28-S100).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. DCIP-1/CXCL3 Protein, Mouse (P.pastoris) is produced in P.pastoris , and consists of 73 amino acids (A28-S100).

Background

CXCL3 is also known as MIP-2 beta, or DCIP-1 in mouse, CINC2 in rat, and GRO-gamma in humans. CXCL3 is a member of the CXC chemokine subfamily, and it is subclassified as a Glu-Leu-Arg (ELR+) CXC chemokine. CXCL3 is originally identified in the supernatants of melanoma cell lines in culture, and is referred to as GRO (growth-related oncogene)[1]. Previous studies have reported that CXCL3 is produced by macrophages, osteoblasts, airway epithelium, dendritic cells, synovial fibroblasts, and cancers[2].
The amino acid sequence of human CXCL3 protein has low homology between mouse and rat CXCL3 protein.
CXCL3 plays an important role in leukocyte chemotaxis, angiogenesis, tumorigenesis, and cell invasion. CXCL3 exerts its functions through a number of signaling pathways including p38 MAPK, ERK1/2 MAPK and JAK2/STAT3 etc., by activating CXCR2 receptor. CXCL3 is highly expressed during the number of tumorous conditions including melanoma, prostate, colorectal, aggressive breast cancer tumors, hepatocellular carcinoma (HCC) and also during hepatic injury and inflammation[3][4].
The cancer types affected by the action of CXCL3 (along with CXCL1 and CXCL2) include prostate cancer, pancreatic cancer, melanoma, lung cancer, hepatocellular carcinoma, and gastric cancer[1]. CXCL3 facilitates adipogenic differentiation through ERK- and JNK-induced induction of c/ebpb and c/ebpd by autocrine/paracrine manners in adipocytes[2]. Furthermore, CXCL3 is also associated with vascular invasion and tumor capsule formation[3]. CXCL3 plays a role in asthma severity and asthmatic airway remodeling[5].

Biological Activity

Measured by its binding ability in a Ca2+ mobilization assay. The ED50 value of mouse DCIP-1/CXCL3 on Ca2+ mobilization assay in CHO-K1/Ga15/mCXCR2 cells (human Ga15 and mouse CXCR2 stably expressed in CHO-K1 cells) is less than 100.0 ng/ml.

Species

Mouse

Source

P. pastoris

Tag

Tag Free

Accession

Q6W5C0 (A28-S100)

Gene ID
Molecular Construction
N-term
CXCL3 (A28-S100)
Accession # Q6W5C0
C-term
Synonyms
rMuDCIP-1/CXCL3; C-X-C motif chemokine 3; Dendritic cell inflammatory protein 1
AA Sequence

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Molecular Weight

Approximately 9 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

DCIP-1/CXCL3 Protein, Mouse (P.pastoris) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DCIP-1/CXCL3 Protein, Mouse (P.pastoris)
Cat. No.:
HY-P7337
Quantity:
MCE Japan Authorized Agent: