1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-27
  5. IL-27 Protein, Mouse (228a.a, HEK293, His)

IL-27 (Interleukin-27) is a heterodimeric cytokine of the IL-12 family, composed of two subunits, EBI3 (Epstein-Barr-virus-induced molecule 3) and p28. IL-27 enhances the development, proliferation, and cytotoxic activity of CD8+ T cells, thereby indirectly promoting anti-tumor immunity[ 2]. IL-27 Protein, Mouse (228a.a, HEK293, His) is a recombinant protein with a His label that consists of two subunits, EBI3 (IL27B) (228 amino acids (M1-P228)) and IL27A (205 amino acids (F29-S234)), and is produced by HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg Get quote
5 μg Get quote
10 μg Get quote
20 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

IL-27 Protein, Mouse (228a.a, HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-27 (Interleukin-27) is a heterodimeric cytokine of the IL-12 family, composed of two subunits, EBI3 (Epstein-Barr-virus-induced molecule 3) and p28[1]. IL-27 enhances the development, proliferation, and cytotoxic activity of CD8+ T cells, thereby indirectly promoting anti-tumor immunity[ 2]. IL-27 Protein, Mouse (228a.a, HEK293, His) is a recombinant protein with a His label that consists of two subunits, EBI3 (IL27B) (228 amino acids (M1-P228)) and IL27A (205 amino acids (F29-S234)), and is produced by HEK293 cells.

Background

IL-27 is mainly produced by cells of myeloid origin such as monocytes, macrophages, dendritic cells, and microglial cells, in response to stimuli acting through Toll-like receptors or TNF-R-family members[3].
The amino acid sequence of human IL-27 protein has low homology for mouse IL-27 protein.
IL-27 acts through a heterodimer receptor consisting of IL-27Rα (WSX1) and gp130 chains, activates the JAK/STAT signaling pathway, which mainly involves STAT1 and STAT3 phosphorylation. STAT3 activation by IL-27 induces the expression of SOCS3, which inhibits further IL-27 signaling in a negative feedback loop, through inhibition of JAK activity[3].
IL-27 plays multiple roles in proinflammatory and anti-inflammatory immune responses. IL-27 enhances NF-κB/AP-1 activity and increases IL-12p40, TNF-α, and IL-6 production, increases TLR4 and TLR5 expression[5]. IL-27 exerts inhibitory effects upon hPMSC adherence and proliferation, and promotes migration of hPMSCs. Besides, IL-27 can upregulate PDL1 expression and enhance the regulatory effects of hPMSCs on Th1 and Th2 cell differentiations and IL-10 secretion from CD4+T cells[6]. IL-27 induces the proliferation and differentiation in hematopoietic stem cells[7]. IL-27 increases IL-10 levels and the expression of p-STAT1, p-STAT3[8]. IL-27 promotes the development and differentiation of CD4+IL-10+ T cells[9].

In Vitro

IL-27 (mouse) (1 ng/mL; 7, 14, 21 days) enhances the differentiation of CD34−KSL HSCs[7].
IL-27 (mouse) (2, 1, 25, 5 ng) increases the expression of p-STAT1, p-STAT3[8].
IL-27 (mouse) (2 ng/ml) significantly up-regulates the differentiation of CD4+IL-1+ T cells[9].

In Vivo

IL-27 (mouse) (5, 1 ng; p.o.; daily for 5 days) increases IL-1 levels in the circulation but not in the distal colon in Rag-/- mice [8].
IL-27 (mouse) (2 ng/mouse; i.p.; daily for 7 days) up-regulates CD4+IL-1+ T cells and suppress inflammation in NOD mice[9].

Biological Activity

1.Measured by its binding ability in a functional ELISA. Immobilized mouse IL27-His at 10 μg/mL (100 μl/well) can bind human IL27RA-Fc and the EC50 is 0.26-0.62 μg/mL.
2. Measured in antiviral assay using HepG2 cells infected with vesicular stomatitisvirus (VSV) and the ED50 is 2-10 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

O35228 (Y19-P228) &GSGSGGSGGSGSGKL& Q8K3I6 (F29-S234)

Gene ID
Synonyms
Interleukin-27 subunit beta; IL-27B; Ebi3; Interleukin-27 subunit alpha; IL-27A; p28
AA Sequence

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Weight

Approximately 60 kDa

Purity

Greater than 85% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Shipping with dry ice.

Documentation
References

IL-27 Protein, Mouse (228a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-27 Protein, Mouse (228a.a, HEK293, His)
Cat. No.:
HY-P73200
Quantity:
MCE Japan Authorized Agent: