1. Recombinant Proteins
  2. Cytokines and Growth Factors GMP-grade Proteins
  3. Interferon & Receptors
  4. IFN-γ
  5. GMP IFN-gamma Protein, Human (HEK293)

GMP IFN-gamma Protein, Human (HEK293)

Cat. No.: HY-P70610G
SDS COA Handling Instructions

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. GMP IFN-gamma Protein, Human (HEK293) is the recombinant human-derived IFN-gamma protein, expressed by HEK293 , with tag free. The total length of GMP IFN-gamma Protein, Human (HEK293) is 143 a.a., with molecular weight of 16 & 18 & 25 kDa, respectively.

GMP-grade recombinant proteins are produced under independent QA supervision, as well as quality records and full traceability.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg $200 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-gamma Protein is a dimeric soluble cytokine. It exerts antibacterial, antiviral and antitumor effects through JAK-STAT, mTOR, MAPK and PI3K/AKT signaling pathways. GMP IFN-gamma Protein, Human (HEK293) is the recombinant human-derived IFN-gamma protein, expressed by HEK293 , with tag free. The total length of GMP IFN-gamma Protein, Human (HEK293) is 143 a.a., with molecular weight of 16 & 18 & 25 kDa, respectively.

Background

IFN-gamma is a dimeric soluble cytokine that is the only member of type II interferon IFN-gamma is produced by immune cells T cells and NK cells and plays an important role in antimicrobial, antiviral and anti-tumor responses by activating effector immune cells and enhancing antigen presentation. IFN-gamma influences gene regulation by interacting with its receptor IFNGR1 through the JAK-STAT pathway, and can also trigger mTOR, MAPK, and PI3K/AKT signaling pathways. IFN-gamma plays a role in the Class I antigen presentation pathway by inducing the substitution of the catalytic proteasome subunit for the immune proteasome subunit. IFN-gamma upregulates the MHC II complex on the cell surface by promoting the expression of several key molecules such as pepsin B/CTSB, H/CTSH, and L/CTSL. IFN-gamma is involved in the regulation of hematopoietic stem cells under developmental and homeostasis conditions by influencing the development, quiescence and differentiation of hematopoietic stem cells[1][2][3][4][5].

Biological Activity

The specific activity is >2×107 IU/mg.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P01579 (Q24-Q166)

Gene ID
Molecular Construction
N-term
GMP IFN-gamma (Q24-Q166)
Accession # P01579
C-term
Synonyms
Interferon Gamma; IFN-Gamma; Immune Interferon; IFNG
AA Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Molecular Weight

16&18&25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 4% Mannitol, 2% Sucrose, 0.02% Tween80, pH 7.4.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GMP IFN-gamma Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMP IFN-gamma Protein, Human (HEK293)
Cat. No.:
HY-P70610G
Quantity:
MCE Japan Authorized Agent: