MTSS1 Protein, Human (His)

MTSS1 Protein is a protein down-regulated in MTSS1 in metastatic bladder carcinoma cell lines. MTSS1 is widely expressed but most abundant in spleen, thymus, testis, prostate and peripheral blood, with low levels also detected in uterus and colon. MTSS1 is proposed to function as a metastatic suppressor protein in both bladder and prostate cancers. MTSS1 Protein, Human (His) is the recombinant human-derived MTSS1 protein, expressed by E. coli , with N-His labeled tag. The total length of MTSS1 Protein, Human (His) is 250 a.a., with molecular weight of ~28 kDa.

MTSS1 Protein is a protein down-regulated in MTSS1 in metastatic bladder carcinoma cell lines. MTSS1 is widely expressed but most abundant in spleen, thymus, testis, prostate and peripheral blood, with low levels also detected in uterus and colon. MTSS1 is proposed to function as a metastatic suppressor protein in both bladder and prostate cancers. MTSS1 enables actin monomer binding activity, dentical protein binding activity and signaling receptor binding activity. MTSS1 is involved in cellular response to fluid shear stress, negative regulation of epithelial cell proliferation and urogenital system development. MTSS1 acts upstream of or within several processes, including actin filament polymerization, adherens junction maintenance and magnesium ion homeostasis. MTSS1 is located in actin Cytoskeleton^[1].

Human

E. coli

N-6*His

EAW92073 (M1-S250)

9788  [NCBI]

MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGS

Approximately 28 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.