1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-BB
  6. PDGF-BB Protein, Mouse (His)

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg USD 120 In-stock
50 μg USD 360 In-stock
100 μg   Get quote  

Get it by tomorrow May 13 for select sizes. Order within 6 hrs 6 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDGF-BB protein is an important member of the PDGF/VEGF growth factor family and plays a vital role in cell signaling and tissue development, contributing to cell growth, angiogenesis and blood vessel development.Its membership emphasizes the importance of fundamental physiological processes that coordinate tissue homeostasis.PDGF-BB Protein, Mouse (His) is the recombinant mouse-derived PDGF-BB protein, expressed by E.coli , with C-6*His labeled tag.

Background

The PDGF-BB Protein is a pivotal member of the PDGF/VEGF growth factor family, indicating its crucial role in cellular signaling and tissue development. As part of this growth factor family, PDGF-BB likely shares conserved structural and functional characteristics with related proteins, contributing to cell growth, angiogenesis, and vascular development. Its membership in the PDGF/VEGF growth factor family highlights its significance in orchestrating essential physiological processes necessary for tissue homeostasis. The study of PDGF-BB provides insights into its specific functions within the context of the growth factor family, offering potential applications in therapeutic interventions and a deeper understanding of its broader impact on cellular processes involved in vascular development and maintenance. Further exploration of PDGF-BB's role promises to enhance our comprehension of its contributions to normal physiology and pathological conditions.

Biological Activity

Measured in a cell proliferation assay using Balb/3T3 cells. The ED50 this effect is ≤23 ng/mL, corresponding to a specific activity is ≥4.34×104 units/mg.

  • Measured in a cell proliferation assay using Balb/3T3 cells. The ED50 this effect is 6.358 ng/mL, corresponding to a specific activity is 1.57×105 units/mg.
Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

AAH53430.1 (S82-T190)

Gene ID
Molecular Construction
N-term
PDGF-BB (S82-T190)
Accession # AAH53430.1
6*His
C-term
Synonyms
PDGFBB; PDGF-BB
AA Sequence

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT

Molecular Weight

Approximately 15.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PDGF-BB Protein, Mouse (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-BB Protein, Mouse (His)
Cat. No.:
HY-P70699
Quantity:
MCE Japan Authorized Agent: