PLA2G1B Protein, Human (HEK293, His)

The PLA2G1B protein is a secreted calcium-dependent phospholipase A2 that targets dietary phospholipids in the intestine. It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol. PLA2G1B Protein, Human (HEK293, His) is the recombinant human-derived PLA2G1B protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PLA2G1B Protein, Human (HEK293, His) is 126 a.a., with molecular weight of 17-20 kDa.

The PLA2G1B protein is a secretory calcium-dependent phospholipase A2 that primarily targets dietary phospholipids in the intestinal tract. It hydrolyzes the ester bond of the fatty acyl group attached at the sn-2 position of phospholipids, with a preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. This protein may play a role in the biosynthesis of N-acyl ethanolamines, which regulate energy metabolism and inflammation in the intestinal tract. It also hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines. It may act in an autocrine and paracrine manner and, when bound to the PLA2R1 receptor, can regulate podocyte survival and glomerular homeostasis. Additionally, PLA2G1B has anti-helminth activity, which is regulated by the gut microbiota. Upon helminth infection of intestinal epithelia, it directly affects phosphatidylethanolamine contents in the membrane of helminth larvae, potentially controlling processes such as membrane fusion and cell division while aiding in immune recognition. This ultimately reduces larvae integrity and infectivity.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

P04054 (A23-S148)

5319  [NCBI]

AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS

17-20 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.