TNF-alpha/TNFSF2 Protein, Guinea (N-His)

TNF-alpha/TNFSF2 protein binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing cell death in specific tumors and causing fever. It can also stimulate cell proliferation, induce insulin resistance, promote angiogenesis, and mediate bone resorption. TNF-alpha's intracellular domain induces IL12 production, highlighting its diverse physiological impact. TNF-alpha/TNFSF2 Protein, Guinea (N-His) is the recombinant TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of TNF-alpha/TNFSF2 Protein, Guinea (N-His) is 156 a.a., with molecular weight of ~19 kDa.

TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Predominantly secreted by macrophages, it possesses the ability to induce cell death in specific tumor cell lines and serves as a potent pyrogen, causing fever through direct action or by stimulating interleukin-1 secretion. TNF-alpha is implicated in the induction of cachexia, and under certain conditions, it can stimulate cell proliferation and induce cell differentiation. Moreover, it induces insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake, contributing to GKAP42 protein degradation in adipocytes and, consequently, TNF-induced insulin resistance. Beyond its metabolic effects, TNF-alpha plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6. Additionally, it promotes osteoclastogenesis, mediating bone resorption, and its intracellular domain (ICD) form induces IL12 production in dendritic cells, underscoring its multifaceted impact on diverse physiological processes.

Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ this effect is 0.04334 ng/mL, corresponding to a specific activity is 2.307×10⁷units/mg.

• 
  Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 0.04334 ng/mL, corresponding to a specific activity is 2.307×10⁷ units/mg.

Others

E. coli

N-6*His

P51435 (L79-L234)

100135630  [NCBI]

LRSASQNDNDKPVAHVVANQQAEEELQWLSKRANALLANGMGLSDNQLVVPSDGLYLIYSQVLFKGQGCPSYLLLTHTVSRLAVSYPEKVNLLSAIKSPCQKETPEGAERKPWYEPIYLGGVFQLQKGDRLSAEVNLPQYLDFADSGQIYFGVIAL

Approximately 19 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.