Search Result

Pathways Recommended:	Metabolic Enzyme/Protease

Results for "

angiotensin-converting enzyme

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Angiotensin Receptor (4) Angiotensin-converting Enzyme (ACE) (170) 11β-HSD (3) Adrenergic Receptor (1) Apoptosis (17) Autophagy (3) Biochemical Assay Reagents (1) Bradykinin Receptor (1) Casein Kinase (3) Caspase (2) CDK (1) Cholinesterase (ChE) (1) Dopamine Receptor (1) Drug Metabolite (12) Endogenous Metabolite (13) GnRH Receptor (1) HIV (1) Influenza Virus (1) Interleukin Related (2) Isotope-Labeled Compounds (15) mAChR (2) MMP (4) Neprilysin (5) NF-κB (6) Opioid Receptor (1) Parasite (3) Reactive Oxygen Species (1) Renin (1) SARS-CoV (4) Sirtuin (4) STAT (4) TNF Receptor (2) Toll-like Receptor (TLR) (2) Xanthine Oxidase (1)
By Research Areas:	Cancer (30) Cardiovascular Disease (154) Endocrinology (5) Infection (7) Inflammation/Immunology (17) Metabolic Disease (17) Neurological Disease (11)

By Targets:

Angiotensin Receptor (4)

Angiotensin-converting Enzyme (ACE) (170)

11β-HSD (3)

Adrenergic Receptor (1)

Apoptosis (17)

Autophagy (3)

Biochemical Assay Reagents (1)

Bradykinin Receptor (1)

Casein Kinase (3)

Caspase (2)

CDK (1)

Cholinesterase (ChE) (1)

Dopamine Receptor (1)

Drug Metabolite (12)

Endogenous Metabolite (13)

GnRH Receptor (1)

HIV (1)

Influenza Virus (1)

Interleukin Related (2)

Isotope-Labeled Compounds (15)

mAChR (2)

MMP (4)

Neprilysin (5)

NF-κB (6)

Opioid Receptor (1)

Parasite (3)

Reactive Oxygen Species (1)

Renin (1)

SARS-CoV (4)

Sirtuin (4)

STAT (4)

TNF Receptor (2)

Toll-like Receptor (TLR) (2)

Xanthine Oxidase (1)

By Research Areas:

Cancer (30)

Cardiovascular Disease (154)

Endocrinology (5)

Infection (7)

Inflammation/Immunology (17)

Metabolic Disease (17)

Neurological Disease (11)

208

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Biochemical Assay Reagents

Peptides

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Targets Recommended: Angiotensin-converting Enzyme (ACE) Angiotensin Receptor NEDD8-activating Enzyme E1/E2/E3 Enzyme IRE1 TET Protein

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P2983

**Angiotensin-converting enzyme** Kininase II; CD143	Endogenous Metabolite	Cardiovascular Disease
Angiotensin-converting enzyme (Kininase II) is a dicarboxypeptidase, it converts inactive Angiotensin I (Ang I) to active Ang II and degrades active bradykinin (BK). Angiotensin-converting enzyme is a potent vasoconstrictor, is often used in biochemical studies .

HY-B0382

Fosinopril sodium 1 Publications Verification SQ28555	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril Sodium is the ester prodrug of an angiotensin-converting enzyme (ACE) inhibitor, used for the treatment of hypertension and some types of chronic heart failure.

HY-B1433

Perindoprilat S 9780	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC₅₀ value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .

HY-P2366

Teprotide SQ-20881	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Teprotide is an inhibitor of angiotensin-converting enzyme (ACE) inhibitor. Teprotide can be used to study hypertensive .

HY-118164

Ro 31-8472	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ro 31-8472 is a Cilazapril (HY-A0043) derivative. Ro 31-8472 is an angiotensin-converting enzyme (ACE) inhibitor .

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

HY-P10391

Ser-Ala-Pro	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ser-Ala-Pro is an X-Pro structure specific angiotensin-converting enzyme (ACE) inhibitory peptide. Ser-Ala-Pro has the potential for hypertension research .

HY-19022

BW A256C	Others	Cardiovascular Disease Others Metabolic Disease
Palatrigine is a compound with angiotensin-converting enzyme inhibitory and beta-adrenergic receptor blocking properties .

HY-B0382R

Fosinopril sodium (Standard)	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril (sodium) (Standard) is the analytical standard of Fosinopril (sodium). This product is intended for research and analytical applications. Fosinopril Sodium is the ester prodrug of an angiotensin-converting enzyme (ACE) inhibitor, used for the treatment of hypertension and some types of chronic heart failure.

HY-P1032F

Biotinyl-Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Endocrinology
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the **angiotensin-converting enzyme** (ACE) .

HY-B0690

Fosinopril SQ28555 free acid	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril (SQ28555 free acid) is the ester proagent of **angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ value of 0.18 μM. Fosinopril demonstrates a non-competitive inhibition effect on ACE activity with an K_i** value of 1.675 μM .

HY-121460

Spiraprilat	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Spiraprilat is a potent angiotensin-converting enzyme (ACE) inhibitor. Spiraprilat has ability to improve left ventricular (LV) function and metabolism in anesthetized open-chest dogs with acute ventricular failure (ALVF) .

HY-A0116A

Trandolaprilate hydrate Trandolaprilat hydrate; RU 44403 hydrate	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease
Trandolaprilate hydrate is a potent **angiotensin-converting enzyme (ACE*) inhibitor. Trandolaprilate hydrate partially inhibits angiotensin-I-mediated c-fos* induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-A0116

Trandolaprilate Trandolaprilat; RU 44403	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease
Trandolaprilate is a potent **angiotensin-converting enzyme (ACE*) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos* induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-B1433S

Perindoprilat-d3 disodium S 9780-d₃ disodium	Angiotensin-converting Enzyme (ACE) Isotope-Labeled Compounds	Cardiovascular Disease
Perindoprilat-d₃ disodium is deuterated labeled Perindoprilat (HY-B1433). Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC₅₀ value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .

HY-A0116R

Trandolaprilate (Standard)	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease
Trandolaprilate (Standard) is the analytical standard of Trandolaprilate. This product is intended for research and analytical applications. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-101681

Utibapril FPL 63547	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Utibapril is an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activities.

HY-108321

Zofenopril	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Zofenopril is an **angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀** of 81 μM.

HY-107337

Delapril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases .

HY-B0279

Ramipril 2 Publications Verification HOE-498	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease Cancer
Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

HY-P0143

Leucylarginylproline	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Leucylarginylproline is an angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 0.27μM.

HY-P4471

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

HY-123657

RXP 407	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RXP 407 is a potent and selective Angiotensin-converting Enzyme (ACE) inhibitor with a K_i of 12nM .

HY-B0384

Temocapril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Temocapril hydrochloride is an orally active **angiotensin-converting enzyme (ACE**) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases .

HY-100713

Temocapril	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Temocapril is an orally active **angiotensin-converting enzyme (ACE**) inhibitor. Temocapril can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases .

HY-B0331A

Enalapril maleate 5+ Cited Publications MK-421 maleate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) maleate, the active metabolite of enalapril, is an angiotensin-converting enzyme (ACE) inhibitor.

HY-A0043

Cilazapril Ro 31-2848	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-A0043A

Cilazapril monohydrate 1 Publications Verification Ro 31-2848 monohydrate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-A0043B

Cilazapril hydrochloride Ro 31-2848 hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-B0477

Quinapril hydrochloride CI-906	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinapril (hydrochloride) (CI-906) is a proagent that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications.

HY-119025

L 681176	Others	Cardiovascular Disease
L 681176 is an angiotensin-converting enzyme inhibitor that can be isolated from STREPTOMYCES sp. MA 5143a .

HY-P4546

Abz-Ser-Pro-3-nitro-Tyr	Angiotensin-converting Enzyme (ACE)	Others
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

HY-P1488

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

HY-101577

NCX899	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NCX899 is a NO-releasing derivative of enalapril, and shows inhibitory activity against angiotensin-converting enzyme (ACE) activity.

HY-P1032

Angiotensin I (human, mouse, rat) 1 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-18207

Fasidotril Alatriopril	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Fasidotril is a dual inhibitor of neprilysin and angiotensin-converting enzyme (ACE) for the potential research of hypertension and congestive heart failure (CHF).

HY-156862

(+)-Chloroquine	Others	Others
(+)-Chloroquine is a aminoquinoline drug impairs in vitro the terminal glycosylation of angiotensin-converting enzyme 2 (ACE-2) .

HY-18206

Lisinopril 4 Publications Verification MK-521	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

HY-B0331

Enalapril MK-421	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) is an angiotensin-converting enzyme (ACE) inhibitor, can be used for hypertensive diseases research .

HY-B0231BS

Enalaprilat-d5 sodium MK-422-d₅ sodium	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalaprilat-d₅ (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-B0231AS

Enalaprilat-d5 MK-422 d₅	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalaprilat-d₅ is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-A0116S

Trandolaprilate-d5 Trandolaprilat d₅; RU 44403 d₅	Isotope-Labeled Compounds Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor[1].

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-108321S

Zofenopril-d5	Isotope-Labeled Compounds Angiotensin-converting Enzyme (ACE)	Neurological Disease
Zofenopril-d₅ is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.

HY-B0331B

Enalapril sodium MK-421 sodium	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalapril (MK-421) sodium is an angiotensin-converting enzyme (ACE) inhibitor, can be used for hypertensive diseases research .

HY-P1044

Spinorphin LVV-hemorphin-4	Others	Neurological Disease
Spinorphin is an inhibitor of enkephalin-degrading enzymes. Spinorphin inhibits aminopeptidase, dipeptidyl aminopeptidase III, angiotensin-converting enzyme and enkephalinase. Spinorphin possesses an antinociceptive effect .

HY-125112

Vicenin-1	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Vicenin 1 is a C-glycosylflavone that has an inhibitory effect on angiotensin-converting enzyme (ACE)(IC₅₀=52.50 μM) .

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH	Caspase Angiotensin-converting Enzyme (ACE)	Others
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-18206A

Lisinopril dihydrate 4 Publications Verification MK-521 dihydrate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Lisinopri dihydrate (MK-521 dihydrate) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

Cat. No.	Product Name

HY-L052

Anti-COVID-19 Compound Library

1,473 compounds

COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs.

Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1,473 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-A0116A

Trandolaprilate hydrate Trandolaprilat hydrate; RU 44403 hydrate	Cardiovascular Disease Structural Classification Alkaloids Pyrrole Alkaloids Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Trandolaprilate hydrate is a potent **angiotensin-converting enzyme (ACE*) inhibitor. Trandolaprilate hydrate partially inhibits angiotensin-I-mediated c-fos* induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-18206

Lisinopril 4 Publications Verification MK-521	Cardiovascular Disease Classification of Application Fields Ketones, Aldehydes, Acids Source classification Endogenous metabolite Disease Research Fields	Angiotensin-converting Enzyme (ACE)
Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

HY-125112

Vicenin-1	Cardiovascular Disease Flavonoids Classification of Application Fields Flavones Leguminosae Source classification Phenols Polyphenols Plants Disease Research Fields Trigonella foenum-graecum Linn.	Angiotensin-converting Enzyme (ACE)
Vicenin 1 is a C-glycosylflavone that has an inhibitory effect on angiotensin-converting enzyme (ACE)(IC₅₀=52.50 μM) .

HY-N9528

Lyciumin A	Cardiovascular Disease Alkaloids Monophenols Pyrrole Alkaloids Classification of Application Fields Source classification Phenols Plants Solanaceae Lycium chinense Miller Disease Research Fields Indole Alkaloids	Angiotensin-converting Enzyme (ACE) Renin
Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension .

HY-N4090

Vicenin 3	Cardiovascular Disease Structural Classification Classification of Application Fields Flavones Source classification Plants Desmodium styracifolium (Osbeck.) Merr. Flavonoids other families Leguminosae Phenols Polyphenols Disease Research Fields	Angiotensin-converting Enzyme (ACE)
Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=46.91 μM) from the aerial parts of Desmodium styracifolium .

HY-A0116

Trandolaprilate Trandolaprilat; RU 44403	Cardiovascular Disease Structural Classification Alkaloids Pyrrole Alkaloids Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Trandolaprilate is a potent **angiotensin-converting enzyme (ACE*) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos* induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-A0116R

Trandolaprilate (Standard)	Structural Classification Alkaloids Pyrrole Alkaloids Source classification Endogenous metabolite	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Trandolaprilate (Standard) is the analytical standard of Trandolaprilate. This product is intended for research and analytical applications. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-B0331

Enalapril MK-421	Cardiovascular Disease Natural Products Classification of Application Fields Disease Research Fields	Angiotensin-converting Enzyme (ACE)
Enalapril (MK-421) is an angiotensin-converting enzyme (ACE) inhibitor, can be used for hypertensive diseases research .

HY-N10860

5-O-beta-D-Glucopyranosylmyricanol	Structural Classification Other Monoterpenes Terpenoids Source classification Morella esculenta (Buch.-Ham. ex D. Don) I. M. Turner Plants Myricaceae	Others
5-O-beta-D-Glucopyranosylmyricanol is a diarylheptane compound isolated from Myrica esculenta that has a weak inhibitory effect on angiotensin-converting enzyme (ACE) .

HY-N1102

Vasicinol 6-Hydroxypeganine	Malvaceae Structural Classification Alkaloids Other Alkaloids Source classification Plants	Angiotensin-converting Enzyme (ACE)
Vasicinol is a reversible inhibitor of sucrase (IC₅₀: 250 μM). Vasicinol is a HbF inducer. Vasicinol also inhibits Angiotensin-converting Enzyme (ACE). Vasicinol is apyrroquinazoline alkaloid that can be isolated from Adhatoda vasica .

HY-N2021

Phosphoramidon	Structural Classification Microorganisms Ketones, Aldehydes, Acids	MMP Angiotensin-converting Enzyme (ACE) Neprilysin Endogenous Metabolite
Phosphoramidon, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC₅₀ of 0.4 μg/mL. Phosphoramidon also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC₅₀ values of 3.5, 0.034, and 78 μM, respectively .

HY-N11970

Isocrenatoside	Structural Classification Labiatae Source classification Phenols Polyphenols Plants Achillea atrata L.	Angiotensin-converting Enzyme (ACE)
Isocrenatoside (compound 6) is a cyclic octapeptide and an inhibitor of angiotensin-converting enzyme (ACE). Isocrenatoside is isolated from the ethanolic extract of Microtoena prainiana stems. Studies have found that the inhibitory efficiency of 1 mg/mL Isocrenatoside can reach 99.3% .

HY-N2165R

Vicenin 2 (Standard)	Cardiovascular Disease Structural Classification Flavonoids Classification of Application Fields Leguminosae Source classification Phenols Plants Disease Research Fields Desmodium styracifolium (Osbeck.) Merr.	Angiotensin-converting Enzyme (ACE)
Vicenin 2 (Standard) is the analytical standard of Vicenin 2. This product is intended for research and analytical applications. Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=43.83 μM) from the aerial parts of Desmodium styracifolium .

HY-N4090R

Vicenin 3 (Standard)	Structural Classification Flavonoids other families Flavones Leguminosae Source classification Phenols Polyphenols Plants Desmodium styracifolium (Osbeck.) Merr.	Angiotensin-converting Enzyme (ACE)
Vicenin 3 (Standard) is the analytical standard of Vicenin 3. This product is intended for research and analytical applications. Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=46.91 μM) from the aerial parts of Desmodium styracifolium .

HY-N2165

Vicenin 2 2 Publications Verification	Cardiovascular Disease Structural Classification Flavonoids Classification of Application Fields Flavones Leguminosae Phenols Polyphenols Plants Disease Research Fields Desmodium styracifolium (Osbeck.) Merr.	Angiotensin-converting Enzyme (ACE)
Vicenin 2, a flavonoid, is an orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀ of 43.83 μM) . Vicenin 2 has radioprotective, anti-nociceptive effects, anti-glycation anti-inflammatory, antioxidant, anticancer, antiangiogenic properties .

HY-N2021A

Phosphoramidon Disodium	Cardiovascular Disease Alkaloids Structural Classification Microorganisms Classification of Application Fields Source classification Disease Research Fields Indole Alkaloids Cancer	MMP Angiotensin-converting Enzyme (ACE) Neprilysin Endogenous Metabolite
Phosphoramidon Disodium, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC₅₀ of 0.4 μg/mL. Phosphoramidon Disodium also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC₅₀ values of 3.5, 0.034, and 78 μM, respectively .

HY-B0130

Perindopril 5 Publications Verification S-9490	Cardiovascular Disease Classification of Application Fields Disease Research Fields	Angiotensin-converting Enzyme (ACE) NF-κB STAT Sirtuin
Perindopril erbumine is an **angiotensin-converting enzyme** inhibitor. Perindopril erbumine modulates NFκB and STAT3 signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure .

HY-122032

A 58365A	Structural Classification Alkaloids Microorganisms Pyrrole Alkaloids Source classification	Angiotensin-converting Enzyme (ACE)
A 58365A is a potent angiotensin converting enzyme (ACE) inhibitor .

HY-N7450

Icariside D2	Infection Structural Classification Natural Products Classification of Application Fields Source classification Plants Annonaceae Inflammation/Immunology Disease Research Fields Annona glabra Linn.	Angiotensin-converting Enzyme (ACE) Apoptosis HIV
Icariside D2, isolated from Annona glabra fruit, inhibits **angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC₅₀** value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .

HY-B0093

Benazepril	Cardiovascular Disease Classification of Application Fields Disease Research Fields	Angiotensin-converting Enzyme (ACE)
Benazepril, an angiotensin converting enzyme inhibitor, which is a medication used to treat high blood pressure.

HY-N2533

Cyanidin 3-sambubioside chloride Cyanidin-3-O-sambubioside chloride	Cardiovascular Disease Structural Classification Classification of Application Fields Source classification Plants Infection Anthocyans Flavonoids other families Phenols Polyphenols Inflammation/Immunology Disease Research Fields	Influenza Virus Angiotensin-converting Enzyme (ACE)
Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride is a H274Y mutation inhibitor, and inhibits influenza neuraminidase activity with an IC₅₀ of 72 μM. Cyanidin 3-sambubioside chloride inhibits angiotensin-converting enzyme (ACE) activity and has antioxidant, anti-angiogenic and antiviral properties .

HY-N9314

Camellianin B	Adinandra nitida Merr. ex Li Flavonoids Classification of Application Fields Flavones Source classification Phenols Polyphenols Metabolic Disease Plants Disease Research Fields Theaceae	Angiotensin-converting Enzyme (ACE)
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities .

HY-14393

Emodin Maximum Cited Publications 21 Publications Verification Frangula emodin	Structural Classification Classification of Application Fields Polygonaceae Source classification Plants Endogenous metabolite Quinones Human Gut Microbiota Metabolites Microorganisms Rheum palmatum L. Anthraquinones Phenols Polyphenols Disease Research Fields Cancer	SARS-CoV Casein Kinase Autophagy 11β-HSD
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

HY-N3470

Isomartynoside	Structural Classification Natural Products Source classification Populus tomentosa Plants Salicaceae	Angiotensin-converting Enzyme (ACE)
Isomartynoside is a potent angiotensin converting enzyme (ACE) inhibitor with an IC₅₀ value of 505.9 µM. Isomartynoside is a phenylpropanoid glycoside that can be found in Galeopsis pubescens . IC₅₀: 505.9 µM (ACE)

HY-A0115

Ramiprilat HOE 498 diacid; Ramipril diacid	Cardiovascular Disease Structural Classification Alkaloids Pyrrole Alkaloids Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields	Drug Metabolite Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .

HY-N0214

Peimisine 2 Publications Verification Ebeiensine	Alkaloids Piperidine Alkaloids Structural Classification Liliaceae Classification of Application Fields Source classification Plants Inflammation/Immunology Disease Research Fields Fritillaria cirrhosa	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis
Peimisine (Ebeiensine) is a muscarinic M receptor antagonist and **angiotensin converting enzyme** (ACE) inhibitor. Peimisine shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .

HY-N0214A

Peimisine hydrochloride Ebeiensine hydrochloride	Alkaloids Piperidine Alkaloids Structural Classification Liliaceae Classification of Application Fields Source classification Fritillaria ussuriensis Maxim. Plants Inflammation/Immunology Disease Research Fields	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis
Peimisine (Ebeiensine) hydrochloride is a muscarinic M receptor antagonist and **angiotensin converting enzyme** (ACE) inhibitor. Peimisine hydrochloride shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .

HY-130199

Psoromic acid Parellic acid	Structural Classification Microorganisms Classification of Application Fields Ketones, Aldehydes, Acids Source classification Metabolic Disease Disease Research Fields	Others
Psoromic acid is a potent and selective RabGGTase (Rab geranylgeranyl transferase) inhibitor with an IC₅₀ value of 1.3 µM. Psoromic acid is an antioxidative agent. Psoromic acid exhibits a competitive type of HMGR inhibition and mixed type of ACE (angiotensin converting enzyme) inhibition .

HY-14393R

Emodin (Standard) Frangula emodin (Standard)	Quinones Structural Classification Rheum palmatum L. Classification of Application Fields Polygonaceae Source classification Phenols Plants Disease Research Fields Cancer	SARS-CoV Casein Kinase Autophagy 11β-HSD
Emodin (Standard) is the analytical standard of Emodin. This product is intended for research and analytical applications. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

HY-107339

Deserpidine Harmonyl	Apocynaceae Alkaloids Piperidine Alkaloids Structural Classification Plants Rauwolfia canescens Indole Alkaloids	Angiotensin-converting Enzyme (ACE)
Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex .

HY-N2298

Camellianin A	Structural Classification Adinandra nitida Merr. ex Li Flavonoids Classification of Application Fields Flavones Source classification Phenols Polyphenols Plants Disease Research Fields Theaceae Cancer	Apoptosis
Camellianin A, the main flavonoid in A. nitida leaves, displays anticancer activity and angiotensin converting enzyme (ACE)-inhibitory activity. Camellianin A inhibits the proliferation of the human Hep G2 and MCF-7 cell lines and induces the significant increase of the G0/G1 cell population .

HY-107339R

Deserpidine (Standard)	Apocynaceae Alkaloids Piperidine Alkaloids Structural Classification Plants Rauwolfia canescens Indole Alkaloids	Angiotensin-converting Enzyme (ACE)
Deserpidine (Standard) is the analytical standard of Deserpidine. This product is intended for research and analytical applications. Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex .

Species:	Human (8) Rhesus Macaque (2) Rat (1) Mouse (2) Cynomolgus (1)
Tag:	His (9) Avi (3) Fc (7)
Source:	HEK293 (13) Sf9 insect cells (2)

Cat. No.	Compare	Product Name	Species	Source

HY-P72029

	ACE2 Protein, Macaca fascicularis (HEK293, hFc) ACE2; angiotensin-converting enzyme	Cynomolgus	HEK293
	ACE2, Macaca fascicularis (HEK 293, hFc) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2, Macaca fascicularis is also an essential regulator of cardiac function and blood pressure control.

HY-P7443

	ACE2 Protein, Human (HEK293, mFc) 1 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, mFc) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7441

	ACE2 Protein, Human (HEK293, His, solution) 2 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, His, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7442

	ACE2 Protein, Human (HEK293, hFc, solution) 1 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human, (HEK293, Fc, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P70769

	ACE2 Protein, Human (Biotinylated, HEK293, His-Avi) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (Biotinylated, HEK 293, His-Avi) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Human is also an essential regulator of cardiac function and blood pressure control.

HY-P7828

	ACE2 Protein, Rhesus macaque (HEK293, His) rRhangiotensin-converting enzyme/ACE-2, His; angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Rhesus Macaque	HEK293
	ACE2 Protein, Rhesus macaque (HEK 293, His) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Rhesus macaque is also an essential regulator of cardiac function and blood pressure control.

HY-P73489

	ACE2 Protein, Human (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (HEK293, His) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag.

HY-P72808

	ACE2 Protein, Human (sf9, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (sf9, His) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

HY-P700445

	ACE2 Protein, Paguma larvata (HEK293, hFc) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Others	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system, converting angiotensin I to anti-hypertrophic angiotensin 1-9 and vasoconstrictor angiotensin II to vasodilator angiotensin 1-7, thereby regulating cardiovascular homeostasis. It can remove the C-terminal residues of vasoactive peptides and cleave a variety of biological peptides. ACE2 Protein, Paguma larvata (HEK293, hFc) is the recombinant ACE2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ACE2 Protein, Paguma larvata (HEK293, hFc) is 723 a.a., with molecular weight of 112.7 kDa.

HY-P700455

	ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

HY-P72809

	ACE2 Protein, Rat (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rat	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system that complexly regulates cardiovascular homeostasis. It specifically converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7, exerting antihypertrophic and vasodilatory effects. ACE2 Protein, Rat (HEK293, His) is the recombinant rat-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag. The total length of ACE2 Protein, Rat (HEK293, His) is 723 a.a., with molecular weight of 105-120 kDa.

HY-P74434

	ACE2 Protein, Mouse (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293

HY-P72810

	ACE2 Protein, Rhesus Macaque (HEK293, Fc) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rhesus Macaque	HEK293
	ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ACE2 protein, expressed by HEK293 , with C-hFc labeled tag.

HY-P74433

	ACE2 Protein, Mouse (HEK293, His-Fc) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293
	ACE2 protein is an important carboxypeptidase in the renin-angiotensin system, which can regulate blood volume and vascular resistance and maintain cardiovascular homeostasis. It converts angiotensin I to the antihypertrophic angiotensin 1-9 and angiotensin II to the vasodilatory angiotensin 1-7, thereby opposing vasoconstriction. ACE2 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived ACE2 protein, expressed by HEK293 , with C-hFc, C-His, C-8*His labeled tag. The total length of ACE2 Protein, Mouse (HEK293, His-Fc) is 723 a.a., with molecular weight of ~130 kDa.

HY-P72807

	ACE2 Protein, Human (Biotinylated, sf9, His-Avi) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-Avi, C-His labeled tag.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Product Name	Chemical Structure

HY-B0231BS

Enalaprilat-d5 sodium
Enalaprilat-d₅ (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-B0231AS

Enalaprilat-d5
Enalaprilat-d₅ is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-108321S

Zofenopril-d5
Zofenopril-d₅ is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.

HY-B0279S

Ramipril-d5
Ramipril-d₅ is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-18206S

Lisinopril-d5
Lisinopril-d₅ is the deuterium labeled Lisinopril. Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

HY-B1433S

Perindoprilat-d3 disodium
Perindoprilat-d₃ disodium is deuterated labeled Perindoprilat (HY-B1433). Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC₅₀ value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .

HY-A0116S

Trandolaprilate-d5
Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor[1].

HY-107337S

Delapril-d3 hydrochloride
Delapril-d₃ (hydrochloride) is the deuterium labeled Delapril hydrochloride. Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases[1].

HY-B0279S1

Ramipril-d3
Ramipril-d₃ is the deuterium labeled Ramipril[1]. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-B0279S2

Ramipril-d4
Ramipril-d₄ is deuterated labeled Ramipril (HY-B0279). Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

HY-B1451S

Imidapril-d3 hydrochloride
Imidapril-d₃ (hydrochloride) (TA-6366-d3) is the deuterium labeled Imidapril hydrochloride. Imidapril hydrochloride (TA-6366) is the hydrochloride salt of Imidapril, an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity[1][2].

HY-117281S1

Moexipril-d3
Moexipril-d₃ is deuterated labeled Moexipril (HY-117281). Moexipril is an orally active inhibitor of **angiotensin-converting enzyme (ACE**), and becomes effective by being hydrolyzed to moexiprila hydrochloride. Moexipril exhibits antihypertensive and neuroprotective effects ^- .

HY-100713S

Temocapril-d5
Temocapril-d₅ is the deuterium labeled Temocapril. Temocapril is an angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].

HY-A0116S1

Trandolaprilate-d6
Trandolaprilate-d₆ is the deuterium labeled Trandolaprilate[1]. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity[2][3].

HY-B0331AS

Enalapril D5 maleate
Enalapril-d₅ (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.

HY-B0130AS

Perindopril-d3 erbumine
Perindopril-d₃ (erbumine) is deuterated labeled Perindopril (erbumine) (HY-B0130A). Perindopril erbumine is an **angiotensin-converting enzyme inhibitor. Perindopril erbumine modulates NF-κB and STAT3** signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure .

HY-B0368S

Captopril-d3
Captopril-d₃ is deuterium labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].

HY-B0592S

Trandolapril-d5
Trandolapril-d₅ is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF)[1].

HY-109592S

Imidaprilate-d5
Imidaprilate-d₅ is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.

HY-117281S

Moexipril-d5
Moexipril-d₅ is the deuterium labeled Moexipril. Moexipril hydrochloride is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure[1][2].

HY-14393S

Emodin-d4

Emodin-d₄ is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].

HY-A0115S1

Ramiprilat-d5
Ramiprilat-d₅ is deuterium labeled Ramiprilat. Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research[1].

HY-A0115S2

Ramiprilat-d4 hydrochloride
Ramiprilat-d₄ hydrochloride is deuterated labeled Ramiprilat (HY-A0115). Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .

Cat. No.	Compare	Product Name	Application	Reactivity

HY-P80003

	ACE2 Antibody ACE-2; ACE 2; angiotensin converting enzyme 2; ACE related carboxypeptidase; ACEH; angiotensin converting enzyme homolog; angiotensin converting enzyme like protein; angiotensin I converting enzyme (peptidyl dipeptidase A) 2; angiotensin I converting enzyme 2; DKFZP434A014; EC 3.4.17; angiotensin-converting enzyme 2 precursor; ACE2_HUMAN; angiotensin-converting enzyme 2; ACE-related carboxypeptidase; angiotensin-converting enzyme homolog; Metalloprotease MPROT15; Processed angiotensin-converting enzyme 2.	WB, ICC/IF, IHC-P, IP	Human, Mouse, Hamster
	ACE2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 92 kDa, targeting to ACE2. It can be used for WB,ICC,IHC-P,IP assays with tag free, in the background of Human, Mouse, Hamster.

HY-P81084

	ACE Antibody angiotensin converting enzyme 1; ACE; ACE-T; angiotensin-converting enzyme isoform 1precursor; Dipeptidyl carboxy peptidase 1; Kininase II; ACE-1; testis-specific isoform precursor. ACE 1; ACE T; ACE1; angiotensin converting enzyme somatic isoform; angiotensin converting enzyme testis specific isoform; angiotensin I converting enzyme; angiotensin I converting enzyme 1; angiotensin I converting enzyme peptidyl dipeptidase A 1; Carboxycathepsin; CD 143; CD143; CD143 antigen; DCP 1; DCP; DCP1; Dipeptidyl carboxypeptidase 1; MVCD3; Peptidase P; Peptidyl dipeptidase A; Testicular ECA; ACE_HUMAN.	WB, IHC-P, FC	Human, Mouse
	ACE Antibody is an unconjugated, approximately 150 kDa, rabbit-derived, anti-ACE monoclonal antibody. ACE Antibody can be used for: WB,IHC-P,FC expriments in human, mouse background without labeling.

HY-P82349

	ACE Antibody (YA2094) ACE; Dipeptidyl carboxypeptidase I; Kininase II; angiotensin converting enzyme 1 Antibody	WB, IHC-P	Mouse, Rat
	Angiotensin Converting Enzyme 1 Antibody (YA2094) is a rabbit-derived non-conjugated IgG antibody (Clone NO.: YA2094), targeting Angiotensin Converting Enzyme 1, with a predicted molecular weight of 151 kDa (observed band size: 180 kDa). Angiotensin Converting Enzyme 1 Antibody (YA2094) can be used for WB, IHC-P experiment in mouse, rat background.