2. Gene
  3. Ace2 - angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 Gene

Ace2 - angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 Gene

  • Gene
  • Protein
  • Agent
  • Ortholog
Mus musculus

Also known as 2010305L05Rik

Gene ID: 70008 | Gene type: protein coding

About Ace2

Summary

Predicted to enable identical protein binding activity; peptidase activity; and virus receptor activity. Involved in positive regulation of cardiac muscle contraction and tryptophan transport. Located in brush border membrane and cytoplasm. Is expressed in several structures, including brain; cardiovascular system; extraembryonic component; genitourinary system; and respiratory system. Used to study COVID-19 and congestive heart failure. Human ortholog(s) of this gene implicated in several diseases, including avian influenza; cerebral malaria; hypertension (multiple); respiratory syncytial virus infectious disease; and severe acute respiratory syndrome. Orthologous to human ACE2 (angiotensin converting Enzyme 2). [provided by Alliance of Genome Resources, Apr 2022]

Ace2 Products(2)

mRNA Protein Name
NM_001130513.1 NP_001123985.1 angiotensin-converting enzyme 2 precursor
NM_027286.4 NP_081562.2 angiotensin-converting enzyme 2 precursor
Gene Ontology
  • Molecular Function
  • Biological Process
  • Cellular Component
Molecular Function GO Annotation Evidence Reference Source
enables protein binding IPI
IPI: Inferred from physical interaction
19185582 MGI
Biological Process GO Annotation Evidence Reference Source
involved in positive regulation of cardiac muscle contraction IMP
IMP: Inferred from mutant phenotype
12075344 MGI
involved in tryptophan transport IMP
IMP: Inferred from mutant phenotype
22837003 MGI
Cellular Component GO Annotation Evidence Reference Source
located in brush border membrane IDA
IDA: Inferred from direct assay
19185582 MGI
located in cytoplasm IDA
IDA: Inferred from direct assay
23535237 MGI
located in plasma membrane IDA
IDA: Inferred from direct assay
23535237 MGI
EXP: Inferred from Experiment IDA: Inferred from direct assay IPI: Inferred from physical interaction IMP: Inferred from mutant phenotype IGI: Inferred from genetic interaction IEP: Inferred from expression pattern
Protein Preferred Names Protein Names

angiotensin-converting enzyme 2

ACE-related carboxypeptidase

angiotensin I converting enzyme 2

Recombinant Ace2 Proteins

Cat. No. Product Name Accession Purity
HY-P74433 ACE2 Protein, Mouse (HEK293, His-Fc) Q8R0I0-1 (Q18-T740) ≥95%
HY-P74434 ACE2 Protein, Mouse (HEK293, His) Q8R0I0-1 (Q18-T740) ≥95%

Related Agents

Approval
Bioactive Molecules (3)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-13771 Ursodeoxycholic acid ≥98.0% Unkown
HY-B0260 Methylprednisolone 99.75% Yes
HY-12404 Diminazene aceturate 99.16% Unkown
Inhibitory Antibodies (2)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-P99346 Regdanvimab Inhibitor 95.00% Unkown
HY-P9801 Anti-Spike-RBD mAb / Unkown
Clinical Phase
Bioactive Molecules (1)
Cat. No. Product Name Effect
Purity Phase
HY-19414 MLN-4760 Inhibitor 99.93% Phase 2
Pre-clinical Phase
Bioactive Molecules (47)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-14393 Emodin Inhibitor 98.95% Yes
HY-110066 (Z)-Guggulsterone 99.30% Unkown
HY-N0639 Punicalin 99.89% Unkown
HY-15275 BMS-265246 Inhibitor 98.92% Unkown
HY-P2536 Mca-Ala-Pro-Lys(Dnp)-OH 99.80% Unkown
HY-122445 Resorcinolnaphthalein Activator 99.87% Unkown
HY-N2116 Ginkgolic acid C17:1 99.90% Unkown
HY-100450 BML-111 Inhibitor ≥98.0% Unkown
HY-P2222A DX600 TFA Inhibitor 99.94% Unkown
HY-B0260R Methylprednisolone (Standard) 99.67% Unkown
HY-P2222 DX600 Inhibitor 99.93% Unkown
HY-19414A (R)-MLN-4760 Inhibitor 99.51% Unkown
HY-D1270 Direct Violet 1 Inhibitor / Unkown
HY-P2616A Mca-YVADAP-Lys(Dnp)-OH TFA Chemical 98.85% Unkown
HY-126419 Kobophenol A Inhibitor 99.90% Unkown
HY-157154 MAT-POS-e194df51-1 Inhibitor 98.45% Unkown
HY-RS00001 ACE2 Rat Pre-designed siRNA Set A Pre-designed Sets / Unkown
HY-138067 SSAA09E2 Inhibitor 98.37% Unkown
HY-P3141 STIEEQAKTFLDKFNHEAEDLFYQSSLASWN 95.28% Unkown
HY-P3142 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ 96.51% Unkown
HY-163943 UNI418 Inhibitor / Unkown
HY-121068 Bisoxatin Inhibitor / Unkown
HY-121421 Diniprofylline Inhibitor / Unkown
HY-14393R Emodin (Standard) Inhibitor / Unkown
HY-149373 Garcinone B Inhibitor / Unkown
HY-149767 CMX990 Inhibitor / Unkown
HY-151497 Antimicrobial agent-10 Inhibitor / Unkown
HY-151501 Antimicrobial agent-11 Inhibitor / Unkown
HY-151502 Antimicrobial agent-12 Inhibitor / Unkown
HY-151900 SARS-CoV-2 Mpro-IN-4 Inhibitor / Unkown
HY-151901 SARS-CoV-2 Mpro-IN-5 Inhibitor / Unkown
HY-156441 SARS-CoV-2-IN-65 Inhibitor / Unkown
HY-156862 (+)-Chloroquine Activator / Unkown
HY-157966 SARS-CoV-2 3CLpro-IN-23 Inhibitor / Unkown
HY-158073 ML2006a4 Inhibitor / Unkown
HY-161261 SARS-CoV-2-IN-81 Inhibitor / Unkown
HY-168267 XH161-180 Inhibitor / Unkown
HY-P2616 Mca-YVADAP-Lys(Dnp)-OH Chemical / Unkown
HY-P3258 SP-10 / Unkown
HY-P4546 Abz-Ser-Pro-3-nitro-Tyr / Unkown
HY-P5827 SBP1 peptide / Unkown
HY-RS00152 ACE2 Human Pre-designed siRNA Set A / Unkown
HY-RS00154 ACER2 Human Pre-designed siRNA Set A Pre-designed Sets / Unkown
HY-161070 Antiviral agent 46 Inhibitor / Unkown
HY-162550 Jobosic acid Inhibitor / Unkown
HY-162598 CET-1 Inhibitor / Unkown
HY-W342283 Diminazene / Unkown
Inhibitory Antibodies (1)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-P990731 Canvircept / Unkown

Orthologs Information

Species Symbol Source ID
Homo sapiens Ace2 NCBI NCBI:59272
Macaca fascicularis Ace2 NCBI NCBI:102130864
Rattus norvegicus Ace2 NCBI NCBI:302668
Macaca mulatta Ace2 NCBI NCBI:712790